KEGG   Methanococcus maripaludis C5: MmarC5_0009Help
Entry
MmarC5_0009       CDS       T00491                                 

Definition
tetrahydromethanopterin S-methyltransferase subunit H (EC:2.1.1.86)
Orthology
K00584  
tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC5_0009
  Energy metabolism
   00680 Methane metabolism
    MmarC5_0009
Enzymes [BR:mmq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MmarC5_0009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5510..6469)
Genome map
AA seq 319 aa AA seqDB search
MFRFDKEQMVIEFAGAKFGGQPGEYPTALSGTIFYARHKIVEDAKKGIFDKKAAEALINK
QAEMQDITGNSAFVQVFGGTEEALVNYIDFVSEVWDGPMLLDSTSGKARMAAANRATEAG
YAKQCVYNSINVAAEDEEIENLTNSDVEASIVLCFDPMDPSVGGKLNVLNDGGKTKDIGM
LELAEKAGIKYPLIDVAVTPMGNGAGHAVRASFAVKAKLGLPVGSGIHNVPSAWDWLREF
RKGLREEGKDQISKDVHHVCDIGANIVQTMASGDYVLYGPIDNAELAFPAVAMTDMIIAE
TAKEMGTATVAEHPLNKLI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtttagatttgacaaagaacaaatggtcattgagttcgctggtgcaaaattcggtgga
caaccaggagaataccctaccgcattatccggtacaattttctacgcaagacacaaaatt
gtagaagatgctaaaaaaggtatcttcgataaaaaagctgctgaagctttaattaacaaa
caagctgaaatgcaagacattacaggaaactcagcattcgtgcaagttttcggcggtaca
gaagaagctttagttaactacattgatttcgtttccgaagtatgggacggtccaatgtta
ctcgattcaacatccggtaaagcaagaatggccgctgcaaacagagctacagaagcagga
tacgcaaaacagtgtgtttacaactcaattaacgttgctgcagaagatgaagaaattgaa
aacttaacaaacagtgatgttgaagcttcaatcgttttatgtttcgacccaatggatcca
tccgttggaggtaaattgaacgtattaaacgatggtggtaaaacaaaagacatcggtatg
ttagaacttgcagaaaaagcaggtattaaatacccactcatcgacgttgcagtaacccca
atgggtaacggtgcaggtcacgctgttagagcatcattcgctgttaaagcaaaactcggt
ttacccgtaggaagtggtattcacaacgtaccttccgcatgggactggcttagagaattc
agaaaaggattaagagaagaaggcaaagatcagatctcaaaagacgtacaccacgtatgt
gacattggtgcaaacattgtacaaacaatggcttcaggtgactacgttttatacggtcca
atcgacaatgctgaactcgcattccctgcagttgcaatgaccgatatgatcatcgcagaa
accgcaaaagaaatgggaactgcaactgttgcagaacacccattaaacaaattaatttaa

DBGET integrated database retrieval system