KEGG   Methanococcus maripaludis C5: MmarC5_0070Help
Entry
MmarC5_0070       CDS       T00491                                 

Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC5_0070
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC5_0070
   00020 Citrate cycle (TCA cycle)
    MmarC5_0070
   00620 Pyruvate metabolism
    MmarC5_0070
   00640 Propanoate metabolism
    MmarC5_0070
   00650 Butanoate metabolism
    MmarC5_0070
  Energy metabolism
   00680 Methane metabolism
    MmarC5_0070
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MmarC5_0070
Enzymes [BR:mmq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MmarC5_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
60288..60818
Genome map
AA seq 176 aa AA seqDB search
MIEVRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDEKIRL
RSQIYEPNYVIVQDPTLMDSVDVTSGLKDGGKILINTLKDIDLNGYDVQTIDATGIALEV
LGVPIVNTVLCGAFAGITGEVTIESLKKAILETFPGKLGPKNAEAAEKAYNLIKGL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagttagattccacggaagagggggacagggtgcagtaacagcggctcaaatt
cttgctaaagctgcattctacgacggtaagttctgccaggcttttccattctttggtgtg
gaaagaagaggggctcccgtaatggcatttacaagaattgacgatgagaaaataagattg
aggagccaaatttacgaaccaaattatgtaatagtacaggatccaacattaatggattca
gtagacgttacaagcgggcttaaagacggcggaaaaatattgataaacacattaaaagac
atagatctaaatggttacgatgttcaaacaatagatgctacaggaatagcattagaagtt
cttggggttcctattgtaaacacagtactttgtggagcttttgctggaattactggagaa
gttactattgaatcacttaaaaaagcaattttagaaacatttcctggtaaattaggacct
aaaaatgcagaagcagcagaaaaagcatacaatttaataaaaggtctgtaa

DBGET integrated database retrieval system