KEGG   Methanococcus maripaludis C5: MmarC5_0072Help
Entry
MmarC5_0072       CDS       T00491                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00010  Glycolysis / Gluconeogenesis
mmq00020  Citrate cycle (TCA cycle)
mmq00620  Pyruvate metabolism
mmq00633  Nitrotoluene degradation
mmq00640  Propanoate metabolism
mmq00650  Butanoate metabolism
mmq00680  Methane metabolism
mmq00720  Carbon fixation pathways in prokaryotes
mmq01100  Metabolic pathways
mmq01120  Microbial metabolism in diverse environments
mmq01130  Biosynthesis of antibiotics
mmq01200  Carbon metabolism
Module
mmq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mmq_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC5_0072
   00020 Citrate cycle (TCA cycle)
    MmarC5_0072
   00620 Pyruvate metabolism
    MmarC5_0072
   00640 Propanoate metabolism
    MmarC5_0072
   00650 Butanoate metabolism
    MmarC5_0072
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC5_0072
   00680 Methane metabolism
    MmarC5_0072
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MmarC5_0072
Enzymes [BR:mmq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MmarC5_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: ABO34389
JGI: MmarC50072
UniProt: A4FW18
Position
61114..62277
Genome map
AA seq 387 aa AA seqDB search
MSEVKVITGTSAAAEAAKLADVDVIAAYPITPQTTCVEKLADFVANGELNAEYIKVESEH
SAMSASIAASATGARTFTATSSQGLALMHEVLFAAAGMRVPVVMMNANRALSAPINIWND
QQDSLSQRDTGWIQLYAEDNQEVLDLVIQAFKIAEDEKVLLPVMVNLDGFILTHTVEPVT
LPKQESVLDFIGSYEPKHAYLDPKKPMTQGSLGDPNYYMETRYAIETAMRNAEKVIADVH
DAFAEKFNRAYGNGLIESYNLEKAENVIVAMGSICGTIKDMIDLKKKEGVEIGLLKIRCY
RPLPVEMIKDALKNAKNVAILDKSISLGMNKGAIYADVASFLKDKKTVNYIVGLGGRDIT
PEDILGIYVDVETSEDGKTNWVGLKEE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagttaaagttatcacaggaacttctgcagctgctgaagctgcaaagcttgca
gatgtagatgttattgcagcatatccaattacgccgcagaccacatgtgtagaaaaactt
gcagattttgtagctaatggtgaattaaatgcagaatacatcaaagtggaaagtgagcat
tctgcaatgagtgcaagtattgcggcaagtgcaacaggtgcaagaacatttactgcaaca
tcatcacaaggtttagcattaatgcacgaagttttatttgctgcagcaggaatgagagtt
ccagttgtaatgatgaatgcaaacagggcattatctgcaccaattaacatttggaacgac
cagcaagacagtttatctcaaagagatactggatggatacaactatatgctgaagacaat
caggaagttttagatctggttattcaggcatttaaaattgcagaagatgaaaaagttctt
cttccagttatggtaaatttagacggttttattttaacacacaccgtagaaccagttact
cttccaaaacaggaaagtgtactcgattttatcggaagttatgaaccaaaacatgcatac
ttggaccctaaaaaaccaatgactcaaggttcgcttggtgatccaaattactacatggaa
acaagatacgcaattgaaactgcaatgagaaacgctgaaaaagttattgcagacgttcac
gacgcttttgcagaaaaattcaacagggcttacggaaacgggctcattgaaagttacaat
ttggaaaaagcagaaaacgtaattgttgcaatgggttcaatttgtggaaccattaaagat
atgatcgaccttaagaaaaaagaaggcgtagaaatcggtttattgaaaataagatgctac
agaccactccctgttgaaatgattaaagatgcactcaaaaatgctaaaaatgttgcaatt
ctcgataaaagcataagccttggtatgaacaaaggtgcaatttatgcggacgttgcatca
tttttgaaagataaaaagaccgtaaattacatcgtaggtcttggtggaagagatattact
cctgaagatattttaggaatttacgtggatgtagaaacatctgaagacggaaaaacaaac
tgggtcggattgaaggaagaataa

DBGET integrated database retrieval system