KEGG   Methanococcus maripaludis C5: MmarC5_0072Help
Entry
MmarC5_0072       CDS       T00491                                 

Definition
pyruvate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:mmq01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmq00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mmq00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mmq00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mmq00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mmq00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mmq00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:mmq00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
61114..62277
Genome map
AA seq 387 aa AA seqDB search
MSEVKVITGTSAAAEAAKLADVDVIAAYPITPQTTCVEKLADFVANGELNAEYIKVESEH
SAMSASIAASATGARTFTATSSQGLALMHEVLFAAAGMRVPVVMMNANRALSAPINIWND
QQDSLSQRDTGWIQLYAEDNQEVLDLVIQAFKIAEDEKVLLPVMVNLDGFILTHTVEPVT
LPKQESVLDFIGSYEPKHAYLDPKKPMTQGSLGDPNYYMETRYAIETAMRNAEKVIADVH
DAFAEKFNRAYGNGLIESYNLEKAENVIVAMGSICGTIKDMIDLKKKEGVEIGLLKIRCY
RPLPVEMIKDALKNAKNVAILDKSISLGMNKGAIYADVASFLKDKKTVNYIVGLGGRDIT
PEDILGIYVDVETSEDGKTNWVGLKEE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagttaaagttatcacaggaacttctgcagctgctgaagctgcaaagcttgca
gatgtagatgttattgcagcatatccaattacgccgcagaccacatgtgtagaaaaactt
gcagattttgtagctaatggtgaattaaatgcagaatacatcaaagtggaaagtgagcat
tctgcaatgagtgcaagtattgcggcaagtgcaacaggtgcaagaacatttactgcaaca
tcatcacaaggtttagcattaatgcacgaagttttatttgctgcagcaggaatgagagtt
ccagttgtaatgatgaatgcaaacagggcattatctgcaccaattaacatttggaacgac
cagcaagacagtttatctcaaagagatactggatggatacaactatatgctgaagacaat
caggaagttttagatctggttattcaggcatttaaaattgcagaagatgaaaaagttctt
cttccagttatggtaaatttagacggttttattttaacacacaccgtagaaccagttact
cttccaaaacaggaaagtgtactcgattttatcggaagttatgaaccaaaacatgcatac
ttggaccctaaaaaaccaatgactcaaggttcgcttggtgatccaaattactacatggaa
acaagatacgcaattgaaactgcaatgagaaacgctgaaaaagttattgcagacgttcac
gacgcttttgcagaaaaattcaacagggcttacggaaacgggctcattgaaagttacaat
ttggaaaaagcagaaaacgtaattgttgcaatgggttcaatttgtggaaccattaaagat
atgatcgaccttaagaaaaaagaaggcgtagaaatcggtttattgaaaataagatgctac
agaccactccctgttgaaatgattaaagatgcactcaaaaatgctaaaaatgttgcaatt
ctcgataaaagcataagccttggtatgaacaaaggtgcaatttatgcggacgttgcatca
tttttgaaagataaaaagaccgtaaattacatcgtaggtcttggtggaagagatattact
cctgaagatattttaggaatttacgtggatgtagaaacatctgaagacggaaaaacaaac
tgggtcggattgaaggaagaataa

DBGET integrated database retrieval system