KEGG   Methanococcus maripaludis C5: MmarC5_0180Help
Entry
MmarC5_0180       CDS       T00491                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00300  Lysine biosynthesis
mmq01100  Metabolic pathways
mmq01120  Microbial metabolism in diverse environments
mmq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MmarC5_0180
Enzymes [BR:mmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MmarC5_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer DUF1700 Peptidase_M28 DUF5382 Methyltransf_18
Motif
Other DBs
NCBI-ProteinID: ABO34497
JGI: MmarC50180
UniProt: A4FWC2
Position
complement(145743..146990)
Genome map
AA seq 415 aa AA seqDB search
MKSILDETIEISSDLIAINSVNPTFGGVGEKEKSIYIKNKLKEYHEKYSIKNCKISEYNT
IDSNGIERPNIVSKYDFGKDTSLTIISHMDIVPEGDFGLWNSDPFKAEIKDGIIYGRGSE
DNHKGIVSSFLLLKMIFEEKIYPKYNLNLIFVSDEEDGSEYGLSYLVNNFKNELFDSKDL
IIVPDFGMPEGEFIEIAEKNILWLNFKIKGKQCHGSTPENGFNADVMAFSFGKGLYDTLY
NKYSELDSIFNPPFSTFEPTILRNNVENTNTIPGYVELNFDCRIIPKYDPKEVLVDIENY
IEDFKNEIEKHVVHFDISEKENISIEYEILKLEKTEKTKTDSEVVEKLGSAIKNVLNKEP
VLCGMGGGTVAAFLREKKYNVAVWGIGYETAHQPNEHIKIEHLIQMAEIYLDILK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtattttggatgaaactattgaaatatcgtctgatttaatagcaataaactcg
gtaaatccaacttttggtggagttggagaaaaagaaaagtcaatttacataaaaaataaa
ttaaaagaatatcatgaaaagtattcgataaaaaactgtaaaataagtgaatacaataca
atcgattctaacggaatagaaaggccaaatatcgtttcaaaatacgactttggaaaagat
acatcattaacaataatttcccacatggatatcgtccctgagggtgattttggtctttgg
aattccgatccgttcaaagctgaaataaaagacgggataatttatggcagaggcagtgaa
gacaatcataaaggaatcgtttcatcttttttacttttaaaaatgatttttgaagaaaaa
atctatccaaaatacaatttaaatctaatttttgtgtcagatgaagaggatggtagtgaa
tacgggctttcatatcttgtaaataactttaaaaatgaactttttgattcgaaagacttg
ataatcgttccagattttggaatgcccgaaggagaatttatagaaattgccgaaaaaaat
atactctggctaaattttaaaattaaggggaaacagtgtcatggaagtacccctgaaaat
ggatttaacgcagatgttatggcgttttcatttggaaaagggctctatgatacattatat
aataaatacagtgaacttgattcgatattcaatccaccattttcaacgtttgaacctaca
attttaagaaataatgttgaaaacacaaatacgattccaggatacgttgaattgaacttt
gattgcagaataattccaaaatacgatccaaaagaagtattggtggatattgaaaactac
attgaagattttaaaaacgaaattgaaaaacatgttgttcactttgatatttctgaaaaa
gaaaatatttcaatagaatatgaaattttaaaacttgaaaaaacggaaaaaacaaaaact
gattcagaagttgtggaaaaattaggatctgcaattaaaaatgtgttaaataaagaacct
gttttatgtgggatgggcggtggaaccgttgctgcatttttgagggaaaaaaaatacaat
gttgcagtttgggggatagggtatgagactgcacaccaaccaaacgaacatatcaaaata
gaacatttgatacaaatggctgaaatttatctcgatatcttaaaataa

DBGET integrated database retrieval system