KEGG   Methanococcus maripaludis C5: MmarC5_0317Help
Entry
MmarC5_0317       CDS       T00491                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC5_0317
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC5_0317
   00620 Pyruvate metabolism
    MmarC5_0317
   00640 Propanoate metabolism
    MmarC5_0317
  Energy metabolism
   00680 Methane metabolism
    MmarC5_0317
Enzymes [BR:mmq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MmarC5_0317
Lipid biosynthesis proteins [BR:mmq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MmarC5_0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
279418..281097
Genome map
AA seq 559 aa AA seqDB search
MVSLVNKYVKKTDFESYEDFVENFKIDVPENFNFAYDIVDEYAKIAPEKTAIIWCDDNND
EKIFTFKDMKKYSDKAANFFLKHGIKKGDTVMLTLKSRYEFWFCMLGLHKIGAVAIPATH
MLTTKDIVYRIEKAGLKMIVCIGENGVPEYVDEAVSEINSNVLKACVVNLNNKNWIDFSK
ELEESSEEFTRPVGEMDTKNEDVLVAYFSSGTTGYPKLIQHDHEYPLGHITTAKYWQNVE
DDGLHYTVADSGWAKCIWGKLYGQWIAGTAVFVYDYDRFDAGNMLEKIAKYKITTFCAPP
TIYRFMIKQDISKVDFSSLHYAVTAGEPLNPEVYNKFLEFTSLRLMEGFGQTETVVSVAN
FPWMDPKPGSMGKPVPIFDLMIKGSDGKECDVGEEGELVFKTKDGKPLGLFSGYFKDPER
TKKSWYDGYYHTGDTAWKDEDGFLWFVGRNDDLIKSSGYRIGPFEVESALISHPAVLECA
ITGVPDPVRGQIVKATIVLTGDYEASEELKKELQDHVKHNTAPYKYPRAIDFVKELPKTI
SGKIRRVEIREQDEEKSNN
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggtatctttagttaataaatatgttaaaaaaacggactttgagtcatacgaagacttt
gtggaaaattttaagatagacgttcctgaaaacttcaactttgcttatgatattgttgat
gaatatgcaaaaattgcacccgaaaagactgcaatcatatggtgtgatgacaataacgac
gaaaaaatttttacattcaaagatatgaaaaaatacagtgataaagcagctaatttcttt
ttaaaacacggaattaaaaagggcgacactgtaatgctcacattaaagagcagatatgaa
ttctggttttgtatgcttggacttcataaaatcggggctgttgcaattcctgcaacacac
atgcttacaacaaaagatattgtatatagaattgaaaaagcaggcttaaaaatgatagta
tgcatcggtgaaaacggtgttcctgaatacgttgatgaagcagtatctgaaattaattct
aatgttttaaaagcctgtgttgtaaatttaaacaacaaaaattggattgatttttcaaaa
gaattggaagaatcatcagaagagtttacaaggcctgttggcgaaatggatactaaaaat
gaagatgtattggttgcatacttttcatccggaacaacaggatatccaaaattaatccag
cacgaccatgaatatcctctaggacatattacaactgcaaaatactggcaaaacgtagaa
gatgatggacttcactatactgttgcagacagtggttgggcaaagtgtatctggggaaaa
ctatatggtcagtggattgcaggaactgcggtatttgtctatgactacgacagatttgat
gcaggaaacatgcttgaaaaaattgcaaaatataaaattacaacgttctgcgcaccacct
acaatttacaggttcatgatcaagcaggatatttcaaaagtagacttttcaagtttgcac
tatgctgtaacggctggagaaccgttaaaccctgaagtttacaacaaatttttggaattc
acaagtctcagattaatggaaggatttggacagactgaaacagttgtttcagttgcaaac
ttcccgtggatggatcctaaacctggatcaatgggaaaaccggtaccaatttttgatttg
atgataaaagggtccgatggaaaagaatgcgatgttggtgaagaaggagaactcgtattc
aagacaaaagatggaaaaccactcggtcttttttcaggatacttcaaagaccctgaaaga
accaaaaaatcatggtacgatgggtactaccatactggcgacaccgcatggaaagatgaa
gatgggttcctctggtttgttggaagaaatgacgatttgatcaaaagttcgggttacaga
attggtcctttcgaagtagagagtgcacttatttcacaccctgcggtactcgaatgcgcc
ataactggagttcctgatcctgtaaggggccagatagttaaagctacaattgttttaaca
ggggattatgaagcaagtgaagaactcaaaaaagaacttcaggatcacgttaaacacaat
actgccccatacaaatatccaagggcaattgactttgtaaaagaactcccaaaaacaatc
agtgggaaaattaggcgtgtagaaatccgagaacaggatgaagaaaaaagtaataattaa

DBGET integrated database retrieval system