KEGG   Methanococcus maripaludis C5: MmarC5_0468Help
Entry
MmarC5_0468       CDS       T00491                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
mmq  Methanococcus maripaludis C5
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(425637..426689)
Genome map
AA seq 350 aa AA seqDB search
MSTLDYLKILATEKGISGREDKVREYMEKELEKYCDSIETDKFGNLIAKKGSTGPKIMIA
SHMDEIGLMVKFIDDKGFLKFTKIGGINDQMLLNQKVIVHSNEGDIVGVLGSKPPHKMKE
SERNKLISAEHMFIDIGAKNKEDAEKMGVEIGTAISFKSEFDNLGGNVVSCKSFDNRAGC
AVVLKTMELLKDMDLKCQVYAVGTVQEEVGLKGAKTSAFGINPDIAFALDVTICGDHPGI
KLEDAPVELGKGPVATIVDASGRGIITHPTVLRMVRDVAKADEIPVQYEVGEGGTTDATA
IHLTRDGIPTGVISVPSRYIHTPVEVIDTEDLEKTTELVVACIKKVHEYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtacactcgattatttaaagattctcgcaacagaaaaaggaatttctggaagagaa
gataaagtaagagaatacatggaaaaagaacttgaaaaatactgtgacagcattgaaaca
gataaatttggaaatttaattgcaaaaaaaggatcaactggtccaaaaattatgattgca
tcacacatggatgaaatcggacttatggttaagttcatcgatgacaaaggatttttaaaa
tttacaaaaattggtggaattaacgaccagatgcttttaaaccagaaagtcatcgttcac
agcaacgaaggcgatattgttggtgttttaggttcaaaaccacctcacaaaatgaaagaa
agcgaaagaaacaagttaatttctgctgaacacatgtttatcgacatcggtgcaaaaaat
aaagaagatgcagaaaaaatgggtgttgaaatcggtactgcgatttcattcaagtctgaa
ttcgacaacctcggtggaaacgtagtttcatgtaaatcatttgacaacagggcaggctgt
gcagttgttttgaaaaccatggaattacttaaagatatggatttaaaatgtcaggtttac
gctgttggaaccgttcaggaagaagttggattaaaaggtgcaaaaacatctgcatttgga
attaatcccgatattgcattcgcacttgatgttacaatctgtggagaccacccgggaatt
aaattagaagatgcaccagtggaacttggaaaaggccctgttgctacaatcgtagatgca
tctggaagaggaattattacacacccaacagttttaagaatggttagagatgttgcaaaa
gcagatgaaattcctgtccaatatgaagttggagaaggaggaactactgatgcaactgca
atccacttaacaagagatggaattccaacaggagttatatccgttccttcaagatacatc
cacacaccagttgaagttattgatacagaagaccttgaaaaaacaaccgaactcgttgtt
gcgtgcattaaaaaagtacacgaatacttttaa

DBGET integrated database retrieval system