KEGG   Methanococcus maripaludis C5: MmarC5_0479Help
Entry
MmarC5_0479       CDS       T00491                                 

Definition
succinyl-CoA synthetase (ADP-forming) subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC5_0479
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MmarC5_0479
   00640 Propanoate metabolism
    MmarC5_0479
   00660 C5-Branched dibasic acid metabolism
    MmarC5_0479
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC5_0479
Enzymes [BR:mmq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MmarC5_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(435282..436370)
Genome map
AA seq 362 aa AA seqDB search
MKLHEYEAKEIFKENGIPVPKNKLTCGKVDSIEYPVVIKAQVLVGGRGKAGGILFADNLD
DANKKIESLIGNTVKGELVEKVLLDEQIKIAKEYYVGVVVNRNEKNNVVIFSTEGGVDIE
EVASKTPEKIIKLPLESGKEFLPYLAREMLKKAGIPSAEIPKVADVLCKVYKAFKNMDGI
LAEINPLVFTEDGKIIAADAVLNIDDDAYFRHKYDKFEEFKKQEKSEFAYVELDGDIAVI
GNGAGLTLASMDIVKEFGGEPACFLDVGGGSNRETVKKALLKATSRKNVKGAFINILGGI
TRCDEVSLGIVDVLKENPNLKFAVRMMGTNEEKGRKILSENGVSFENSMEGAARALTELI
NS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcacgaatatgaagcaaaggaaatttttaaagaaaatggaatccctgttcca
aaaaacaaacttacatgcggtaaagtcgacagtatcgagtaccctgtcgttataaaagcg
caagtattagtcggtggaagaggaaaagctggcggaatattatttgcagataatttagat
gatgcaaacaaaaaaattgaatcattgattggaaacacagtaaaaggagaactcgttgaa
aaagtactccttgatgaacaaattaaaattgcaaaagaatactatgttggcgttgttgtt
aacaggaacgaaaaaaacaatgttgtcatattttcaacagaaggtggagtagatattgaa
gaagtggcttcaaaaactcccgaaaaaataataaaattaccgttagaatctggaaaagaa
tttttaccataccttgcaagagaaatgctcaaaaaagcaggcattccgagtgcagaaatt
ccaaaagttgcggatgttttatgcaaagtttacaaagcattcaaaaacatggatggaatt
ttagctgaaataaacccgttggtatttaccgaagatggaaaaatcattgctgctgatgca
gttttgaatattgatgacgatgcgtactttagacataaatacgataaatttgaagaattt
aaaaaacaggaaaaatccgaatttgcatatgttgaacttgatggggacattgcagttatt
ggaaacggtgcaggactcacccttgcaagcatggacattgtaaaagagttcggcggagaa
cctgcatgtttcttagatgttggtggcggttccaatagagaaactgtaaaaaaagcactt
ttaaaagcaacttcaagaaaaaatgttaaaggagcgtttatcaacattcttggtggaatt
acaagatgcgatgaagtttcacttggaattgtagatgttttaaaagaaaatcctaacctc
aagtttgcagttaggatgatggggactaacgaagaaaaaggaagaaaaattctatctgaa
aatggagtaagtttcgaaaattcaatggaaggggctgcaagagcacttactgaattaata
aacagttaa

DBGET integrated database retrieval system