KEGG   Methanococcus maripaludis C5: MmarC5_0493Help
Entry
MmarC5_0493       CDS       T00491                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MmarC5_0493
   00052 Galactose metabolism
    MmarC5_0493
   00500 Starch and sucrose metabolism
    MmarC5_0493
   00520 Amino sugar and nucleotide sugar metabolism
    MmarC5_0493
Enzymes [BR:mmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MmarC5_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
448269..449117
Genome map
AA seq 282 aa AA seqDB search
MVKKAIIPAAGFGTRLLPITKAQPKEMLPVLGKPIIQYVIEDLAEAGIENILIITGRGKY
AIENHFDKNFELEDRLKKDGKCGALKTIQEINDFAHIYYIRQGKQKGLGDAVYCGREFIC
EDYTIVMVGDTIYSGNVPKKLIEAHEKYKCSVIALERVPKEDVFKYGVISGKEIENGIFE
VNDLIEKPNVEEAPSNLIITGAYLLSSKIFGHIENIELGKGGEIQLTDAMKTLLKEEKII
GVEVDFKRYDIGDIKGWLEANVELGIENIEGFKEYIQDLCEE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaagctatcatacctgcagcaggatttggaacaagacttcttccaattacg
aaggcacagcctaaagaaatgctcccagttttaggaaaaccaattatacagtatgtaata
gaagatttggctgaagcaggaattgaaaatatacttattattacaggacgtggaaagtac
gcaattgaaaaccattttgataaaaattttgaactagaggatcgattaaaaaaagatgga
aagtgtggggcattaaaaacaattcaggaaataaatgactttgcacatatttattacatt
aggcaagggaaacagaaaggtcttggggatgcagtatattgtggacgagaatttatttgt
gaagattataccatcgtaatggttggagatacaatttattcaggaaatgtaccaaagaaa
ctaatcgaagcacatgaaaaatataaatgttcagtaattgctcttgaaagagttccaaaa
gaagatgtttttaaatatggggtaatttcaggaaaagaaattgaaaatggaattttcgaa
gtaaatgacctcatcgagaagccaaatgttgaggaagcaccttcaaatttgataattact
ggtgcataccttctatcttcaaaaatatttggtcatatcgaaaatatcgaacttggaaaa
gggggggaaatacaattgacggatgccatgaaaacattattaaaagaagaaaaaataatt
ggtgtcgaagttgatttcaaaaggtatgatataggggatattaaaggatggcttgaagca
aatgtggaacttggaattgaaaacattgaaggatttaaagaatatattcaagatctttgc
gaggaatag

DBGET integrated database retrieval system