KEGG   Methanococcus maripaludis C5: MmarC5_0493Help
Entry
MmarC5_0493       CDS       T00491                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mmq00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mmq00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mmq00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mmq00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
448269..449117
Genome map
AA seq 282 aa AA seqDB search
MVKKAIIPAAGFGTRLLPITKAQPKEMLPVLGKPIIQYVIEDLAEAGIENILIITGRGKY
AIENHFDKNFELEDRLKKDGKCGALKTIQEINDFAHIYYIRQGKQKGLGDAVYCGREFIC
EDYTIVMVGDTIYSGNVPKKLIEAHEKYKCSVIALERVPKEDVFKYGVISGKEIENGIFE
VNDLIEKPNVEEAPSNLIITGAYLLSSKIFGHIENIELGKGGEIQLTDAMKTLLKEEKII
GVEVDFKRYDIGDIKGWLEANVELGIENIEGFKEYIQDLCEE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaagctatcatacctgcagcaggatttggaacaagacttcttccaattacg
aaggcacagcctaaagaaatgctcccagttttaggaaaaccaattatacagtatgtaata
gaagatttggctgaagcaggaattgaaaatatacttattattacaggacgtggaaagtac
gcaattgaaaaccattttgataaaaattttgaactagaggatcgattaaaaaaagatgga
aagtgtggggcattaaaaacaattcaggaaataaatgactttgcacatatttattacatt
aggcaagggaaacagaaaggtcttggggatgcagtatattgtggacgagaatttatttgt
gaagattataccatcgtaatggttggagatacaatttattcaggaaatgtaccaaagaaa
ctaatcgaagcacatgaaaaatataaatgttcagtaattgctcttgaaagagttccaaaa
gaagatgtttttaaatatggggtaatttcaggaaaagaaattgaaaatggaattttcgaa
gtaaatgacctcatcgagaagccaaatgttgaggaagcaccttcaaatttgataattact
ggtgcataccttctatcttcaaaaatatttggtcatatcgaaaatatcgaacttggaaaa
gggggggaaatacaattgacggatgccatgaaaacattattaaaagaagaaaaaataatt
ggtgtcgaagttgatttcaaaaggtatgatataggggatattaaaggatggcttgaagca
aatgtggaacttggaattgaaaacattgaaggatttaaagaatatattcaagatctttgc
gaggaatag

DBGET integrated database retrieval system