KEGG   Methanococcus maripaludis C5: MmarC5_0591Help
Entry
MmarC5_0591       CDS       T00491                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MmarC5_0591
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MmarC5_0591
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MmarC5_0591
Enzymes [BR:mmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MmarC5_0591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
555111..556295
Genome map
AA seq 394 aa AA seqDB search
MKCEGYFGEFGGQFIPEVLMPAIDELKEAYFELKDDEDFQNELSYYLKNYAGRETPLYYA
ENLTNKLGGAKIYLKREDLLHGGAHKTNNTIGQALLAKRMGKTRIIAETGAGQHGVGTSM
AGALFGLETEIFMGRLDTERQQPNVFRMKLLGAKVTPVDTGSKVLKDAVNEAMRNWTATF
ENTHYLIGTVMGPHPFPTIVRDFQSVIGKEVKKQIMEQEGRLPDHLIACIGGGSNALGLF
HAFIQYKDVRMVGIEAAGKGLNTSLHGASISKGKKGVLHGMLSYFLQDEDGQIEEAYSIS
AGLDYPGIGPEHAYLHDSGRAEYASATDDQALSAFMELTRSEGIIPALESSHAVAYAIEN
AGNMDKDEIMVINLSGRGDKDLNTVIDIMQKRGM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtgaaggatactttggagaatttggtgggcagtttatccctgaagttttgatg
cctgcaattgatgagctcaaagaagcatattttgagttaaaagatgacgaagactttcaa
aacgagctttcttactatttgaaaaattatgcaggacgtgaaacaccgctttactatgct
gaaaatttaaccaataaactcggcggtgcaaaaatttacttaaaaagagaagatttactt
cacggtggagctcacaaaactaacaatactatcggtcaggcgttacttgctaaaagaatg
ggtaaaacaagaataattgcagaaacaggtgcaggacagcacggtgttggaacttcaatg
gcgggagcattgtttggactcgaaactgaaattttcatgggaaggcttgataccgaaaga
cagcaaccaaacgtatttagaatgaaacttcttggtgcaaaggttacaccagttgataca
ggttcaaaagttttaaaagatgcggtaaacgaagcaatgaggaattggactgcaacattt
gaaaatacacattatttaatcggaactgtaatggggccacacccattcccaacgattgtt
agggatttccagtccgtaattggaaaagaagttaaaaaacaaattatggaacaggaagga
agacttccagaccacctaattgcatgcattggtggtggaagcaatgcgcttggtttattc
cacgcatttattcaatataaagacgttaggatggttggaatcgaagctgcaggaaaagga
cttaatacaagtcttcacggagcatccatttcaaaaggaaagaaaggagttcttcatgga
atgctttcatactttttacaggatgaagacggccaaattgaagaagcatacagtatttca
gcaggattagactatcctggaatcggtccagaacacgcatatttacacgattctggaaga
gcagagtatgcatctgcaactgatgatcaggcattaagcgcatttatggaacttacaaga
agtgaaggaataattccagctttagaatcttcacacgcggtagcttatgcgattgaaaat
gcaggaaacatggataaagatgaaataatggtcataaacctttcaggaaggggcgacaaa
gatttaaacaccgtaatcgacatcatgcaaaaaagagggatgtaa

DBGET integrated database retrieval system