KEGG   Methanococcus maripaludis C5: MmarC5_0592Help
Entry
MmarC5_0592       CDS       T00491                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmq01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mmq00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mmq00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
556296..557075
Genome map
AA seq 259 aa AA seqDB search
MNKPVLVSFLVSGDPNPDATLKFMKTLDKYSGVIELGIPFSDPVADGPTIQAADVRALSN
GFKIAKSFEVLKEFRKESDTPVILMTYYNPVFKRGIENFVISAKEAGAKGLIIVDLPLQE
ATEYREICKKHEMGTVFLAAPNTPEERLKISDEASTEFLYLISTFGITGARDTFEQMTFD
FIKRARTTCKGKICVGFGISKGSHAESLIEQGADGVIVGSAFVDIIKNYGDSEEALVKLE
EFAKELSEGIDKGYEKRNK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacctgtgttagtcagttttttagtttctggagatccaaatccggatgcaaca
ttgaaatttatgaaaacactcgataaatattcgggagtaatcgagcttggaattccattc
agcgatcctgttgcagacggaccaacgattcaagcggcagatgtaagggcactttcaaac
ggatttaaaattgcaaaatcctttgaagtattgaaagaatttagaaaagagtctgatacc
cctgtaattttgatgacatattacaatccagtatttaaaagaggaatcgaaaacttcgta
attagtgccaaagaagcaggtgcaaaagggcttattattgttgatttgccacttcaagaa
gcaactgaatatagagaaatctgcaaaaaacacgaaatgggaacggtatttcttgcagca
ccaaacactcccgaagaacgtttaaaaatatctgatgaagcaagtactgaatttttatat
cttatttcaacttttgggataactggtgcaagggatacctttgaacagatgacttttgat
tttattaaacgagcaaggacaacatgcaaaggaaaaatctgtgttggatttggaatttca
aaaggaagtcatgcagaaagtttaatcgagcaaggtgctgatggagtaattgttggaagt
gcttttgtagacattattaaaaattacggagattcagaagaagcgcttgttaaattagaa
gaattcgcaaaagaattaagcgaaggaattgataaaggatacgaaaaaagaaataaataa

DBGET integrated database retrieval system