KEGG   Methanococcus maripaludis C5: MmarC5_0592Help
Entry
MmarC5_0592       CDS       T00491                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MmarC5_0592
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MmarC5_0592
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MmarC5_0592
Enzymes [BR:mmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MmarC5_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
556296..557075
Genome map
AA seq 259 aa AA seqDB search
MNKPVLVSFLVSGDPNPDATLKFMKTLDKYSGVIELGIPFSDPVADGPTIQAADVRALSN
GFKIAKSFEVLKEFRKESDTPVILMTYYNPVFKRGIENFVISAKEAGAKGLIIVDLPLQE
ATEYREICKKHEMGTVFLAAPNTPEERLKISDEASTEFLYLISTFGITGARDTFEQMTFD
FIKRARTTCKGKICVGFGISKGSHAESLIEQGADGVIVGSAFVDIIKNYGDSEEALVKLE
EFAKELSEGIDKGYEKRNK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacctgtgttagtcagttttttagtttctggagatccaaatccggatgcaaca
ttgaaatttatgaaaacactcgataaatattcgggagtaatcgagcttggaattccattc
agcgatcctgttgcagacggaccaacgattcaagcggcagatgtaagggcactttcaaac
ggatttaaaattgcaaaatcctttgaagtattgaaagaatttagaaaagagtctgatacc
cctgtaattttgatgacatattacaatccagtatttaaaagaggaatcgaaaacttcgta
attagtgccaaagaagcaggtgcaaaagggcttattattgttgatttgccacttcaagaa
gcaactgaatatagagaaatctgcaaaaaacacgaaatgggaacggtatttcttgcagca
ccaaacactcccgaagaacgtttaaaaatatctgatgaagcaagtactgaatttttatat
cttatttcaacttttgggataactggtgcaagggatacctttgaacagatgacttttgat
tttattaaacgagcaaggacaacatgcaaaggaaaaatctgtgttggatttggaatttca
aaaggaagtcatgcagaaagtttaatcgagcaaggtgctgatggagtaattgttggaagt
gcttttgtagacattattaaaaattacggagattcagaagaagcgcttgttaaattagaa
gaattcgcaaaagaattaagcgaaggaattgataaaggatacgaaaaaagaaataaataa

DBGET integrated database retrieval system