KEGG   Methanococcus maripaludis C5: MmarC5_0791Help
Entry
MmarC5_0791       CDS       T00491                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MmarC5_0791 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    MmarC5_0791 (hisD)
Enzymes [BR:mmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MmarC5_0791 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
759845..761119
Genome map
AA seq 424 aa AA seqDB search
MIVKKISELNEKDLDIIINRNKTNISGILPTVSEILENVQKNGDNAIKEYTKKFDGVDID
NFKVTSEEIDKAYEKIDSKIVESLEKAYMNIKEFHEIQFKNLTEWEVEKDGIKAGQIIRS
IEKAGCYVPGGRAFYPSTVLMTVTPAKVAGVKKVVVTSPPNGTEGNPATLVASDIAKVDE
IYKIGGAQAIGALAYGTESIPKVDIIVGPGNIFVTAAKKLVYGEVSIDFPAGPSEVLIMC
DESSNEEYVAMDFLAQAEHDPNASCIITVTSEEKAEKIKERILMEMKTAKRTEIIEKSIL
NSAIVTGSIEECIKLSNNYAPEHLEIMTKNPRKVLNSIENAGSIFLGNYAPVPVGDYASG
TNHVLPTSACAKMYSGLSVETFIKKPTVQELTKEGLNKIGDIVTTLAEAEGLFNHSEAVK
RRLN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgatagtcaaaaaaatatccgaattaaacgaaaaagacctagatattataattaacagg
aataaaacaaatatttcagggattttaccgactgtaagcgaaattttagaaaatgttcaa
aaaaatggggataatgcgataaaagaatacactaaaaaatttgacggcgtagacattgat
aatttcaaggtaacttccgaagaaattgataaagcgtatgaaaaaatcgattcaaaaata
gttgaatccctcgaaaaagcttacatgaatattaaagaatttcacgaaattcaatttaaa
aatttaactgaatgggaagttgaaaaggacggaattaaagcgggacagatcatcagatct
attgaaaaggctggatgctatgttccagggggaagagcattttatccatctaccgtttta
atgaccgtaacccctgcaaaagttgcgggtgtaaaaaaagttgttgtaacatccccacca
aatggaactgaaggaaaccctgcaacgcttgttgcttcagacattgcaaaggtggatgaa
atatacaaaattggcggtgcacaggcaattggcgctcttgcatacggtacagaatctatt
ccaaaagtagatattatcgttggaccgggaaatatctttgtaactgccgctaaaaaattg
gtttatggggaagtttcaatagattttccagcaggtccttcagaagttcttattatgtgt
gatgagtcttcgaatgaagaatatgttgcaatggactttttggctcaggctgaacatgac
ccgaatgcatcatgtataataaccgttacttcagaagaaaaagcagaaaaaattaaagaa
agaattttaatggaaatgaaaactgctaaaagaacggaaatcattgaaaaatcaatttta
aattctgcaatcgttacagggtcaattgaggaatgtattaaactttcaaataattacgct
ccagagcatttagaaataatgacgaaaaatccaagaaaagtgttaaattcaattgaaaat
gctggaagtatctttttaggaaattatgcgccagttccagttggagattatgcaagtggc
acaaaccacgttcttccaacgtcagcatgcgcaaaaatgtattccggactcagcgttgaa
acatttatcaaaaagccaacagttcaggaattaacaaaagaaggattaaataaaatcggg
gatatagtaactacccttgcagaagcagaaggattatttaatcattctgaagccgttaaa
agaaggttaaattaa

DBGET integrated database retrieval system