KEGG   Methanococcus maripaludis C5: MmarC5_0874Help
Entry
MmarC5_0874       CDS       T00491                                 

Definition
(GenBank) SSU ribosomal protein S6P modification protein
  KO
K15740  tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MmarC5_0874
Enzymes [BR:mmq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     MmarC5_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3 ATPgrasp_Ter GSP_synth
Motif
Other DBs
NCBI-ProteinID: ABO35182
JGI: MmarC50874
UniProt: A4FY98
Position
complement(853456..854334)
Genome map
AA seq 292 aa AA seqDB search
MRMGIISEERDWVTDELKSKMEKNDIDPVIIQPSKIISSIGSDVKFEQNNRSILDLKCAF
VRNIGEGVEMFHRFDMLKYLENYIPIINPMDGIENAGNKFRTSFLMEVHKIPHPKTIVAE
DVNKALIAADKFEDVVLKPLFGNQGKGLVRVKGRSTVAKLKALNTFKSSHGVIYMQEFVN
NPNNVYRDIRAFAVGDKVVSAMYRTSDNWITNIRQNGVPEKCEITDELTEIVLAAKDAVG
LVYGGVDILESSEGLKVIEVNACPSWEGLSRISDADIAQSLIDEALNYSKEY
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgggaataatttctgaagaaagagactgggtaaccgatgaattgaagtctaaa
atggaaaaaaatgatatcgatccggttattatacagccatcaaaaataatttcatctatt
ggatcagacgttaaatttgaacagaataatagaagtatactcgatttaaaatgcgctttt
gttagaaacatcggtgaaggagttgaaatgtttcacaggtttgacatgttaaagtacctt
gaaaattacatcccgataataaacccgatggatggaattgaaaatgcaggaaataaattc
agaacctcgtttttaatggaagttcacaaaattccacatccaaaaacaatcgttgcagaa
gatgtaaataaagcgttaatcgcagctgataaatttgaagacgttgttttaaaacctctt
tttggaaatcagggaaaaggccttgtaagagttaagggaagatcaaccgttgctaaatta
aaagcactaaatacttttaaaagcagtcatggcgtaatttacatgcaggaatttgtaaat
aatccaaacaatgtctaccgggatattagggcatttgcagttggcgacaaggtagtttct
gcaatgtatcggacatctgacaactggattacaaatatacgccaaaatggagttcctgaa
aaatgcgaaataactgacgaattaactgaaatcgttcttgctgcaaaagatgctgttgga
ctcgtttatggtggtgtagatattcttgaaagcagcgaaggactgaaagttatcgaagta
aatgcatgcccttcatgggaaggactctcaagaatttctgatgcagatattgctcaaagc
ttgattgatgaagctttaaattattcaaaagagtattaa

DBGET integrated database retrieval system