KEGG   Methanococcus maripaludis C5: MmarC5_0889Help
Entry
MmarC5_0889       CDS       T00491                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mmq01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmq01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmq00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mmq00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(871042..871563)
Genome map
AA seq 173 aa AA seqDB search
MILDEVNIPVYAQHMDAVNPGSSTGHILPDALKDAGVTGTLLNHSERRMLLADLEKCIEI
SNKLGLKTVVCTNNIPVSKAVSALNPTSIAVEPPELIGSGIPVSKANPEVVSGTVREVRE
INKNVEILCGAGISKGEDVKSALELGTNGVLLASGVVKAKNVEDAIRELIAEI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaagtaaatatcccagtatatgcgcaacacatggatgcagtaaatcct
ggaagcagtactggacacatattacctgatgcattaaaagatgcaggtgttactggaact
cttttaaaccactctgaaagaagaatgcttcttgcagaccttgaaaaatgcattgaaatt
tcaaataaacttggtttaaagactgttgtatgtacaaacaatatacccgtttcaaaagca
gtttctgcgttaaatccaacgtcaattgcagtagaacctcctgaattaattggaagcgga
ataccagtttcaaaagcaaatcctgaagtggtgtcaggaactgtaagggaagttcgagaa
attaacaaaaatgttgaaatattgtgtggtgcaggcatttcaaaaggagaagatgtaaaa
tctgcgcttgaacttggaacaaacggtgttttgcttgcatcaggtgttgtaaaagctaaa
aacgttgaagatgcaatacgagaattaattgcagaaatctaa

DBGET integrated database retrieval system