KEGG   Methanococcus maripaludis C5: MmarC5_0889Help
Entry
MmarC5_0889       CDS       T00491                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00010  Glycolysis / Gluconeogenesis
mmq00051  Fructose and mannose metabolism
mmq01100  Metabolic pathways
mmq01110  Biosynthesis of secondary metabolites
mmq01120  Microbial metabolism in diverse environments
mmq01130  Biosynthesis of antibiotics
mmq01200  Carbon metabolism
mmq01230  Biosynthesis of amino acids
Module
mmq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmq_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC5_0889
   00051 Fructose and mannose metabolism
    MmarC5_0889
   00562 Inositol phosphate metabolism
    MmarC5_0889
Enzymes [BR:mmq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MmarC5_0889
Exosome [BR:mmq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MmarC5_0889
  Exosomal proteins of bladder cancer cells
   MmarC5_0889
  Exosomal proteins of melanoma cells
   MmarC5_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh His_biosynth IGPS NMO
Motif
Other DBs
NCBI-ProteinID: ABO35196
JGI: MmarC50889
UniProt: A4FYB2
Position
complement(871042..871563)
Genome map
AA seq 173 aa AA seqDB search
MILDEVNIPVYAQHMDAVNPGSSTGHILPDALKDAGVTGTLLNHSERRMLLADLEKCIEI
SNKLGLKTVVCTNNIPVSKAVSALNPTSIAVEPPELIGSGIPVSKANPEVVSGTVREVRE
INKNVEILCGAGISKGEDVKSALELGTNGVLLASGVVKAKNVEDAIRELIAEI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaagtaaatatcccagtatatgcgcaacacatggatgcagtaaatcct
ggaagcagtactggacacatattacctgatgcattaaaagatgcaggtgttactggaact
cttttaaaccactctgaaagaagaatgcttcttgcagaccttgaaaaatgcattgaaatt
tcaaataaacttggtttaaagactgttgtatgtacaaacaatatacccgtttcaaaagca
gtttctgcgttaaatccaacgtcaattgcagtagaacctcctgaattaattggaagcgga
ataccagtttcaaaagcaaatcctgaagtggtgtcaggaactgtaagggaagttcgagaa
attaacaaaaatgttgaaatattgtgtggtgcaggcatttcaaaaggagaagatgtaaaa
tctgcgcttgaacttggaacaaacggtgttttgcttgcatcaggtgttgtaaaagctaaa
aacgttgaagatgcaatacgagaattaattgcagaaatctaa

DBGET integrated database retrieval system