KEGG   Methanococcus maripaludis C5: MmarC5_1244Help
Entry
MmarC5_1244       CDS       T00491                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MmarC5_1244
Enzymes [BR:mmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MmarC5_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1189238..1189972
Genome map
AA seq 244 aa AA seqDB search
MKVVITRPLEKGKDFSEMLENAGFGTIIIPTLELVFKKAEINLEKYSWIVFTSPRGIEGF
FKNLTSKDIEKVLTKKIGAIGIETAKEFEKIFKKPVYVIPDLYTAENLLEALEKQVKPGE
GVLVPTTPSTRDVLKEGLNADLIFVYSSEEPENISKKLEELEKQVISENKNNKKVILTFT
SGLTAKNFFKHCRPEFLELLKEQHVVSIGPITKKNVDSFGFDSLMPEKNYTVEGMLPVIK
ALNI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtaattacacgacctcttgaaaagggaaaagatttttcagaaatgcttgaa
aatgcaggttttggaacaataattattcctacacttgaactggtttttaaaaaagctgaa
ataaatcttgaaaagtattcctggatagtttttacaagccctaggggaattgaaggtttt
tttaaaaatttaacttcaaaagatattgaaaaggttttaactaaaaaaataggtgcaata
ggaattgaaactgcaaaagaatttgaaaaaatctttaaaaaaccagtttacgttattcct
gatctttatactgcagaaaatttgcttgaagcacttgaaaagcaggttaaacctggtgaa
ggggttcttgttccaacaaccccttcaacgagagatgtcttaaaagaaggattaaacgca
gacttaatttttgtttacagctctgaagaaccagaaaacatatctaaaaaattagaagaa
cttgaaaaacaagttatttctgaaaataaaaataataaaaaagtaattttaacatttaca
agtggacttactgcaaaaaacttctttaaacactgtagaccagaatttttagaactttta
aaagagcaacatgttgtctcgattggcccgataacaaagaaaaacgttgattcctttgga
ttcgattctttgatgcctgaaaaaaattatactgttgaaggaatgctccctgtgattaaa
gctttaaatatctga

DBGET integrated database retrieval system