KEGG   Methanococcus maripaludis C5: MmarC5_1346Help
Entry
MmarC5_1346       CDS       T00491                                 

Definition
thymidine phosphorylase (EC:2.4.2.-)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mmq00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1290720..1292237)
Genome map
AA seq 505 aa AA seqDB search
MLFLNAKFIDLDLGENAVIVNEEDLKGTSYYPQDRVLIESHAGSVIGNIYSTKTMVNKGE
VGMLVSELAEISISEGEEVKLRHAEKPESIPFIKKKMDGQVLNPHEIRTIIDEIVSKKLS
NIELSAFVSSTYINGMNMDEISEMTKRIAETGDMIAWEKSLVVDIHSIGGVPGNKYALLS
IPILAAAGITVPKTSSRAITSPAGTADVMEVLTNVELKEEEIKRIVKTTNGCLAWGGGVN
LAPADDIIINVERPVSIDPQPQLLASVMAKKIATGIKYTVIDIPVGKGVKIKNEAEGAKL
ARKFIELGESLNIKVECVLTYGGQPLGRAIGPALEAREAIEALQDPKNAPKSLIEKALSL
AGILLELGGAAQIGEGQNLAWEILESGKALEKFNQIITEQGGTPKKPEEIELGDYVEEIL
APIDGYITDISNTAITNVVKEAGAPRDKKAGILLNSKIGNKVKQGDVLYTIYSGSEERLV
SAINLARRVYPVKVEGMLIERISKF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctatttttaaacgcaaaattcatagaccttgatctaggtgaaaatgcggtaattgtc
aacgaagaggacttaaaaggaacttcgtactatccgcaagatagggtattgattgagtca
cacgcaggttccgtcattggaaacatttattccacaaaaactatggttaacaaaggcgaa
gttggaatgcttgttagtgaacttgcagaaatttccatttcagaaggggaagaagtaaaa
ttaagacacgcagaaaaacctgaatcaattccatttataaaaaagaagatggatggccag
gttttaaatccgcatgaaataagaacgataattgatgaaattgtatctaaaaaactctca
aacattgaattatctgcttttgtttcgtctacgtacataaatggaatgaatatggatgaa
ataagcgaaatgaccaagagaatcgcagaaactggggacatgattgcttgggaaaagagt
ttagttgtggatattcacagcattggtggagttcctggaaataagtacgccttactttca
atcccgatacttgcagcagcaggaattactgttccaaaaacgtcatcaagagcaataact
tcacctgctggaaccgcagatgtaatggaagtgctcacaaatgttgaattgaaagaagaa
gagattaaaagaatagtaaaaactacaaatggatgtcttgcatggggtggaggcgtaaat
ctagctcctgcagatgatataattataaatgtagaacggccggtttcaatagaccctcaa
ccacagcttcttgcaagtgttatggcaaaaaagattgcaacaggaattaaatatactgta
attgatattcccgttggaaaaggggtaaaaattaaaaatgaagcagaaggggcaaaatta
gcaaggaaatttattgaacttggggaatcgctcaatattaaggtggaatgtgtgttaact
tacggtgggcagccacttgggagggcaattggacctgcactcgaagcaagagaagcaatc
gaagcacttcaagatccaaaaaatgctccaaaaagtttaattgaaaaggcactatctctt
gcaggaattcttcttgaactcggaggggctgcacagattggggaaggtcaaaatttagca
tgggaaattttagaatccggaaaagcacttgaaaaatttaatcagattataactgaacag
ggtggaactccgaaaaaacccgaagaaatagaacttggagattatgttgaagaaattctt
gcgccaattgatgggtatattacagatataagtaacactgcaattacaaacgtggttaaa
gaagctggagctccaagggataaaaaagcaggaattttattgaattcaaagattggaaat
aaagtaaaacagggagatgttttatatacaatctattccggatcagaagaaaggcttgtt
tcagcaataaatcttgcaagaagagtttatcctgtaaaggttgaaggaatgcttattgag
agaataagcaaattctaa

DBGET integrated database retrieval system