KEGG   Methanococcus maripaludis C5: MmarC5_1346Help
Entry
MmarC5_1346       CDS       T00491                                 

Definition
(RefSeq) thymidine phosphorylase (EC:2.4.2.-)
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
mmq  Methanococcus maripaludis C5
Brite
Enzymes [BR:mmq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     MmarC5_1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1290720..1292237)
Genome map
AA seq 505 aa AA seqDB search
MLFLNAKFIDLDLGENAVIVNEEDLKGTSYYPQDRVLIESHAGSVIGNIYSTKTMVNKGE
VGMLVSELAEISISEGEEVKLRHAEKPESIPFIKKKMDGQVLNPHEIRTIIDEIVSKKLS
NIELSAFVSSTYINGMNMDEISEMTKRIAETGDMIAWEKSLVVDIHSIGGVPGNKYALLS
IPILAAAGITVPKTSSRAITSPAGTADVMEVLTNVELKEEEIKRIVKTTNGCLAWGGGVN
LAPADDIIINVERPVSIDPQPQLLASVMAKKIATGIKYTVIDIPVGKGVKIKNEAEGAKL
ARKFIELGESLNIKVECVLTYGGQPLGRAIGPALEAREAIEALQDPKNAPKSLIEKALSL
AGILLELGGAAQIGEGQNLAWEILESGKALEKFNQIITEQGGTPKKPEEIELGDYVEEIL
APIDGYITDISNTAITNVVKEAGAPRDKKAGILLNSKIGNKVKQGDVLYTIYSGSEERLV
SAINLARRVYPVKVEGMLIERISKF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctatttttaaacgcaaaattcatagaccttgatctaggtgaaaatgcggtaattgtc
aacgaagaggacttaaaaggaacttcgtactatccgcaagatagggtattgattgagtca
cacgcaggttccgtcattggaaacatttattccacaaaaactatggttaacaaaggcgaa
gttggaatgcttgttagtgaacttgcagaaatttccatttcagaaggggaagaagtaaaa
ttaagacacgcagaaaaacctgaatcaattccatttataaaaaagaagatggatggccag
gttttaaatccgcatgaaataagaacgataattgatgaaattgtatctaaaaaactctca
aacattgaattatctgcttttgtttcgtctacgtacataaatggaatgaatatggatgaa
ataagcgaaatgaccaagagaatcgcagaaactggggacatgattgcttgggaaaagagt
ttagttgtggatattcacagcattggtggagttcctggaaataagtacgccttactttca
atcccgatacttgcagcagcaggaattactgttccaaaaacgtcatcaagagcaataact
tcacctgctggaaccgcagatgtaatggaagtgctcacaaatgttgaattgaaagaagaa
gagattaaaagaatagtaaaaactacaaatggatgtcttgcatggggtggaggcgtaaat
ctagctcctgcagatgatataattataaatgtagaacggccggtttcaatagaccctcaa
ccacagcttcttgcaagtgttatggcaaaaaagattgcaacaggaattaaatatactgta
attgatattcccgttggaaaaggggtaaaaattaaaaatgaagcagaaggggcaaaatta
gcaaggaaatttattgaacttggggaatcgctcaatattaaggtggaatgtgtgttaact
tacggtgggcagccacttgggagggcaattggacctgcactcgaagcaagagaagcaatc
gaagcacttcaagatccaaaaaatgctccaaaaagtttaattgaaaaggcactatctctt
gcaggaattcttcttgaactcggaggggctgcacagattggggaaggtcaaaatttagca
tgggaaattttagaatccggaaaagcacttgaaaaatttaatcagattataactgaacag
ggtggaactccgaaaaaacccgaagaaatagaacttggagattatgttgaagaaattctt
gcgccaattgatgggtatattacagatataagtaacactgcaattacaaacgtggttaaa
gaagctggagctccaagggataaaaaagcaggaattttattgaattcaaagattggaaat
aaagtaaaacagggagatgttttatatacaatctattccggatcagaagaaaggcttgtt
tcagcaataaatcttgcaagaagagtttatcctgtaaaggttgaaggaatgcttattgag
agaataagcaaattctaa

DBGET integrated database retrieval system