KEGG   Methanococcus maripaludis C5: MmarC5_1357Help
Entry
MmarC5_1357       CDS       T00491                                 

Definition
D-fructose 1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC5_1357
   01230 Biosynthesis of amino acids
    MmarC5_1357
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC5_1357
   00030 Pentose phosphate pathway
    MmarC5_1357
   00051 Fructose and mannose metabolism
    MmarC5_1357
  Energy metabolism
   00680 Methane metabolism
    MmarC5_1357
Enzymes [BR:mmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MmarC5_1357
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MmarC5_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1304530..1305681)
Genome map
AA seq 383 aa AA seqDB search
MEEKVTLSVIKADVGGLCGHTLAPEELLDAAEYVLENALDEILTDYYVTNCGDDIDMIMT
HDKGTDNEEVHKLAWDALEAATDVAKELKLYGAGQDLLSTSFSGNVKGLGPGCAEMEFVE
RPSEPVVVFCCDKTDPAAFNLPFYRMFSDPFSTAGLVYDPSMTTGFRYEVLDVMEHKKVF
METPEETYSLLALIGNTEKYAVKRVYRRKDNEIAAVCSSEKLNMIAGEYVGKDDPVAIVR
AQSGFPAVGEVLEGFANPHLVAGWMRGCHFGPIMPVGEEDAMPARFDGPARVMALGFQLS
HGRLVGPNDLFADKSFDKAREKALDMAEMMRSMGPFMPHRLPESMMEYTSVPKVLAQLKD
RFIDIEDKCDCKLDEIRERGDME
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaagtaactctaagtgttattaaggcagacgttggcgggctctgcggacac
acattagctccagaagaattattggatgctgcagaatacgttttagaaaatgcactcgat
gaaattttaactgattattatgttacaaactgtggtgatgatattgacatgatcatgacc
cacgacaaaggaacagacaacgaagaagtacacaaacttgcatgggatgctcttgaagca
gcaaccgatgttgcaaaagagttaaaattatatggtgcaggtcaagacttactttcaact
tcattttcaggaaacgttaaaggactcggcccaggatgcgctgaaatggaatttgttgaa
agaccaagtgaaccagttgtagtattctgctgtgacaaaacagaccctgcagcgttcaat
ttaccattttacaggatgttttcagacccattcagcactgcaggcttagtatacgatcca
tcaatgacaacagggttcagatacgaagttttagatgttatggaacacaaaaaagttttc
atggaaacccctgaagaaacatactcattacttgcattaattggaaacactgaaaaatac
gctgtaaaaagagtttacagaagaaaagacaatgaaattgcagcagtatgttcatcagaa
aaattaaacatgattgcaggagaatacgttggaaaggatgatcctgtagcaatcgtaaga
gctcaaagtggattccctgcggtaggggaagtattagaaggatttgcaaacccacacctc
gttgcaggatggatgaggggatgccactttggacctatcatgcctgttggtgaagaagat
gcaatgcctgcaagatttgacggacctgcaagagttatggctttaggattccagttatca
cacggaagattagttggaccaaacgacctcttcgcagacaaatcattcgataaagcaaga
gaaaaagcactcgatatggctgaaatgatgagatcaatgggtccattcatgccacacaga
ttgcctgaatcaatgatggaatacacatcagttccaaaagttttagcacagttaaaagac
agattcatcgatatcgaagacaaatgcgactgcaaactcgatgaaataagagaaagagga
gacatggaataa

DBGET integrated database retrieval system