KEGG   Methanococcus maripaludis C5: MmarC5_1380Help
Entry
MmarC5_1380       CDS       T00491                                 

Definition
aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC5_1380
   01230 Biosynthesis of amino acids
    MmarC5_1380
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC5_1380
   00030 Pentose phosphate pathway
    MmarC5_1380
   00051 Fructose and mannose metabolism
    MmarC5_1380
  Energy metabolism
   00680 Methane metabolism
    MmarC5_1380
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MmarC5_1380
Enzymes [BR:mmq01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     MmarC5_1380
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MmarC5_1380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1323255..1324181
Genome map
AA seq 308 aa AA seqDB search
MVKKITGDDVLIPLETPESMHKEYIQNYLNLTRNTGNLMLFAGDQKIEHLNEDFYGKDIS
KDDADPEHLFKIAENSKIGGFAVQFGLLSRYGRDHKDINYIVKLNSKTNLVDTNQKDPLS
RALLDINDILEFKKNSGINIVGVGYTIYLGSEYESEMLSEASKIIYEAHKGGLVVILWIY
PRGKAVKDEKDSELISGATGVAACLGADFVKVNYPKSENPAESFKEAVMAAGRTKVVCAG
GSSTDIESFLKQLYEQIHISGASGNATGRNIHQKSLSDAVSMCNAIYAITIDGKTVSEAL
NIYNERKS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaaaaaataaccggtgatgatgtattaattccgctggaaactccagaatcaatg
cataaagaatatatacaaaattacctgaatcttacaagaaatacgggcaatttgatgctt
tttgcaggcgatcagaagatcgaacatttgaacgaagatttttacggaaaagatatttca
aaagatgatgcagatccggaacacctgtttaaaattgctgaaaattcaaaaataggtggt
tttgcggttcagtttggattattatccagatacggcagagatcataaggatataaattac
attgtaaaattaaattcaaaaacgaatcttgtagacacgaatcagaaagaccctttaagc
cgtgcattactggatattaacgatattttggaatttaagaaaaattctggaattaatata
gttggagtaggatacacaatatatcttggaagtgaatatgaatcagagatgctttctgag
gcttcaaaaataatttatgaagctcataaagggggacttgttgtaattctctggatttac
ccgaggggaaaagccgtaaaagatgaaaaagactcagaactaatttctggagctacgggt
gttgcagcgtgtcttggagctgattttgtaaaagtaaattacccaaaatcagaaaatcct
gcagaatcatttaaagaagccgttatggctgccggaagaactaaagtagtctgtgcaggc
ggatcaagtacagatattgaatcatttttaaaacagctctacgaacagattcacataagc
ggagcgtcaggaaatgccactggaagaaacatccatcaaaaatcattatcagatgccgtt
tcaatgtgtaatgcgatatatgcaataacaattgacggaaaaactgtttcagaagcttta
aatatatacaacgaaagaaaatcttaa

DBGET integrated database retrieval system