KEGG   Methanococcus maripaludis C5: MmarC5_1527Help
Entry
MmarC5_1527       CDS       T00491                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00010  Glycolysis / Gluconeogenesis
mmq00620  Pyruvate metabolism
mmq00640  Propanoate metabolism
mmq00680  Methane metabolism
mmq00720  Carbon fixation pathways in prokaryotes
mmq01100  Metabolic pathways
mmq01110  Biosynthesis of secondary metabolites
mmq01120  Microbial metabolism in diverse environments
mmq01130  Biosynthesis of antibiotics
mmq01200  Carbon metabolism
Module
mmq_M00357  Methanogenesis, acetate => methane
mmq_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC5_1527
   00620 Pyruvate metabolism
    MmarC5_1527
   00640 Propanoate metabolism
    MmarC5_1527
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC5_1527
   00680 Methane metabolism
    MmarC5_1527
Enzymes [BR:mmq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MmarC5_1527
Lipid biosynthesis proteins [BR:mmq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MmarC5_1527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABO35824
JGI: MmarC51527
UniProt: A4G040
Position
complement(1467401..1469311)
Genome map
AA seq 636 aa AA seqDB search
MKTGDKYILLEKYSEMQQKALEDPEKFWGEQAKCLEWDKTWDNVLEWNPPYAKWFKSGSL
NASYNCVDRHIKGNRRNKAAIICEKEDGSCGILTYYELYREINKFANVLENLGVEKGDVV
TIYMPMMTEAIIAMLACSRIGVIHNVVFSGFSSDALADRINDSKSKILVTTNLLYRRGKE
IELKKILDKALLNCNSIKHVVYVKRGIEEFNLVSGKEYFWDELMGGAKSYVEPVPVESDH
PLFILYTSGTTGSPKGVVHSTGGYLTYATKTMDWTWGLNEMDVFWCTADIGWITGHTYVV
YGPLSLGATIVLYEGAIDYPEPDRLWGIVENHGVTLLYTAPTAIRMLMMYGEKWVNTHDL
STLRLLGSVGEPINPRAWKWYYKVIGKEKCPICDCYWQTETGGHMIYPAIGIQSVPLKPG
SATFPGIGIDVDVVDNEGNPVEANIKGNLIIKRPWPGMLAGLWNNDERYRAAYWDRFKNN
FSTSDYAIKDQDGYIWVLGRSDEVLNVSGHRIGTAELEHELVSNKMVAESAVVGKPDDVK
GEVPVAFVILNERYRELPSNEVKATLIRHIRDTVGPIGTPAMIFFVNKLPKTRSGKIMRR
ILKKLIIGEEIGDVTTLEDNTSLEDVKKELEDFKYD
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgggagataaatatatactgcttgaaaaatattcggaaatgcagcagaaagct
ttggaagatcctgaaaaattctggggggagcaagcaaaatgtttagaatgggataaaaca
tgggataacgtactggagtggaatccaccttacgcaaaatggttcaaaagcggcagttta
aatgcaagctataattgtgttgatagacacataaaaggaaacaggagaaataaggcggcc
ataatctgtgaaaaagaggatggaagttgtggaattttaacatattatgaattataccga
gaaataaataaatttgcaaatgttcttgagaatttgggtgttgaaaaaggggatgtagtc
acaatatacatgccaatgatgaccgaggcaattattgcaatgcttgcatgttcgagaatc
ggggtaatccataacgttgtattttctggattttcatcagatgcgcttgctgaccggata
aacgattcaaaatcaaaaatattggtgactacaaacctgttgtaccgacgtggaaaagag
attgaacttaaaaaaatattggataaagcactattaaattgtaattcaataaaacacgta
gtttatgtaaaaaggggaatcgaagaatttaatttagtttctggaaaagaatacttctgg
gatgaattaatgggcggtgctaaaagctacgtggaacctgttcctgtagaatcagatcac
cccctatttattctttacacgagtggtacaaccggaagtccaaaaggagtggttcactca
acagggggatatttaacttacgctacaaaaaccatggattggacatggggattaaatgaa
atggatgtattttggtgtactgcggacattggatggattacgggtcacacttacgtagtg
tatggcccattatcacttggtgctacgatagtactctatgaaggtgcgatagactaccct
gaacccgacaggttatgggggattgtggaaaatcacggagttaccttactttacaccgca
ccaaccgcgataagaatgctcatgatgtacggtgaaaaatgggtaaatacccacgattta
tcaacattgaggcttttaggaagtgtaggggaaccgataaatccaagagcttggaaatgg
tactataaagtaattgggaaagaaaaatgcccaatttgtgactgctactggcaaacagaa
accggaggacacatgatttatcctgcaatcggaatccagtcagttccattaaaaccaggt
tctgcaacgtttccaggaatcggaattgacgttgacgttgtggacaacgaaggaaatccc
gtagaagcaaatataaaaggaaaccttattataaaaaggccatggccaggaatgcttgca
gggctgtggaataacgatgaaagataccgtgcagcatactgggatagatttaaaaacaac
ttttcaacatctgactatgcaataaaggatcaggatggatacatctgggtattgggacga
tctgacgaagtattgaatgtttcaggacacaggataggaacagcggaactcgaacacgag
cttgtgtcaaataagatggttgcagagtctgcagtagttggaaaacctgacgatgtaaaa
ggagaagttcctgttgcatttgttatattaaacgaaagataccgtgaacttccatcaaat
gaagtaaaggctacacttatccggcatatcagggatactgttggcccaattggaactcct
gcaatgatattcttcgtaaataagcttccaaaaacaagaagtggaaagataatgagaaga
atcttgaaaaaactcataataggcgaagaaataggcgatgttactacattggaagataat
acgagtctagaagatgttaaaaaagagcttgaagatttcaagtatgattaa

DBGET integrated database retrieval system