KEGG   Methanococcus maripaludis C5: MmarC5_1574Help
Entry
MmarC5_1574       CDS       T00491                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mmq  Methanococcus maripaludis C5
Brite
Enzymes [BR:mmq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MmarC5_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1519096..1519734)
Genome map
AA seq 212 aa AA seqDB search
MPLNEIIGVIGNLISKGYIQKQSVIDALMSVPRHKFIPKAMEEYAYIDSPLGIGCGQTIS
AIHMVGIMCEELDLDVGQNVLEVGTGSGYHAAVVSEIVGESGKVTTIERIPELFEKSKQV
LSELGYENVEVVLGDGTKGYLENAPYDRIYVTASGPNVPIALFEQLNDGGIILAPVGSHF
QTLMRYKKINGKIFKEKLLEVAFVPLIGENGF
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaacgaaattattggggttattggaaacttaatttcaaaaggttatatccaa
aaacagagcgtaattgatgcattaatgagcgttccaaggcacaaatttattcctaaagcc
atggaagaatacgcatacatcgacagccctttaggaatcggatgcggccagacaatttct
gcaatacacatggttggaataatgtgtgaagaactcgatctggatgtggggcagaatgtg
cttgaagttggaaccggttcggggtatcatgcagcagtagtttctgaaattgttggtgaa
tctggaaaagttacaacgatagaacgaatacctgaactttttgaaaaatcaaagcaagta
ctctcagaacttggatacgagaatgttgaagtggttttgggggatggtacaaaaggatat
ttggaaaatgcaccatatgatcggatatatgttactgcgtctggaccaaatgttccaata
gcactttttgaacagttaaatgatggtggaataatacttgcacctgttggaagccatttt
cagactttaatgagatacaagaaaataaatggtaaaatattcaaagaaaaacttctggaa
gttgcttttgttccattaatcggtgaaaatggcttttga

DBGET integrated database retrieval system