KEGG   Methanococcus maripaludis C5: MmarC5_1750Help
Entry
MmarC5_1750       CDS       T00491                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mmq00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mmq00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1696998..1697906
Genome map
AA seq 302 aa AA seqDB search
MRHLISMRDIGREEILNILDESERMEAILNEKGHCDFLNGRILATLFYEPSTRTRLSFET
AMKRLGGNVIGFTDISNTSVTKGESLADTIKVISGYSDLIAIRHPSEGAARLSGENSKVP
VINAGDGSNQHPTQTLLDLYTIKREVGHIENLKIAFIGDLKYGRTVHSLCQALSLFKGVE
IKLISPEELKMPREVIEDIDGKIKLSEMTDVEIEDVDVVYMTRIQKERFVDVNEYYKVKG
IYRLSKEHIGDKDVVIMHPLPRVDEIDSEVDNLPQARYFKQSFYGVPVRMAILKLLFEDS
VK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatttaatttcgatgagggacatcggtcgggaagaaattttgaatattttagac
gaatccgaaagaatggaagctattttaaatgaaaaaggtcactgtgattttttaaacggg
agaatactcgcaactcttttttacgaaccatcaaccagaacaagactttcttttgaaact
gcaatgaagcggcttggtggaaatgttatcggttttacggatatttcaaatacttctgta
acaaagggcgaatctttagcagatactatcaaagtaatcagcggttacagtgatttaatt
gcaataagacatccttcagaaggggctgcaaggctttcaggtgaaaattcaaaagttcca
gtcataaacgctggagatggatcaaaccagcacccgacacagacacttcttgatttatat
acaattaaaagggaagtcggacacattgaaaatttaaaaatcgcatttatcggtgactta
aagtatggaagaaccgttcactctttgtgccaagcattatccctctttaagggtgtagaa
ataaagttaatttctccagaagaacttaaaatgccaagagaagtaattgaagatatcgat
ggaaaaataaaactttcggaaatgactgacgttgaaattgaagatgttgatgttgtttac
atgacaaggattcagaaagaaaggtttgtcgacgttaacgaatactacaaggtaaaggga
atataccgactttcaaaagagcacattggagacaaagacgtagttatcatgcacccgctt
ccaagggttgatgaaatcgattccgaagtcgataatcttccacaggcaagatactttaaa
cagtcattttatggagttcctgtcagaatggcgattttaaagcttttatttgaagattcg
gtaaaataa

DBGET integrated database retrieval system