KEGG   Methanococcus maripaludis C5: MmarC5_1824Help
Entry
MmarC5_1824       CDS       T00491                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mmq  Methanococcus maripaludis C5
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MmarC5_1824
Enzymes [BR:mmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MmarC5_1824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1770996..1771844)
Genome map
AA seq 282 aa AA seqDB search
MYFEDYSKFIAAYDNFNDADFVIFGIPFDATTSYKPGARFGPDEVRNASWGLETFSPILK
RDLIDVKICDKYNLLMEGYQSEIINRAYNASKDILEAKKIPVMIGGEHSVTYPVVKAVKS
VYNDFAVIHFDAHCDLREEYMGNEQSHASVMRRSYDLTKDIFQFGIRSGDQDEWEFGWAN
TNISMEMPTKDDIKKIKELEKPVYLTIDIDVLDPAFVPGTGTPEPCGFTPKELMNSLYLL
EEIKEKIIGFDVVEVSPHYDIGKITSVTAAKIIRELILTINK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtattttgaagattactccaagtttattgccgcttatgataattttaacgatgctgat
tttgttatttttggaatcccatttgatgctacaacctcatacaaacctggggcacgattt
ggaccggatgaagttagaaacgcttcgtggggacttgaaacatttagcccgattttaaag
agagatttaatcgatgtaaaaatttgcgacaagtacaatcttttaatggaaggataccag
tctgaaatcataaaccgggcatacaatgcttcaaaagatattttagaagctaaaaaaatt
cctgtaatgattggtggagaacattctgtaacttaccctgttgtaaaagctgtaaaatca
gtttacaatgactttgcagtaattcattttgatgcacactgtgatttaagagaagaatat
atgggaaacgaacaatcccatgcaagtgtgatgagaagaagttacgatttaacgaaagat
atcttccaatttggaattagaagtggcgaccaagacgaatgggaatttggatgggcgaac
accaatatttcaatggaaatgcctacaaaagacgatatcaaaaagattaaagaacttgaa
aaaccggtttacttgacaattgacattgatgtactcgatcctgcatttgtaccaggaact
ggaacccctgagccttgcgggtttactccaaaagaacttatgaattcactttaccttttg
gaagaaattaaagaaaagattattggtttcgacgtggttgaagtttcacctcattacgac
atcggcaagattacatctgttacagcggcaaaaatcattcgtgaattgatactcaccata
aacaaataa

DBGET integrated database retrieval system