KEGG   Methanococcus maripaludis C5: MmarC5_1832Help
Entry
MmarC5_1832       CDS       T00491                                 

Definition
(GenBank) histone acetyltransferase, ELP3 family
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
mmq  Methanococcus maripaludis C5
Brite
Enzymes [BR:mmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MmarC5_1832
Transfer RNA biogenesis [BR:mmq03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MmarC5_1832
Chromosome and associated proteins [BR:mmq03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    MmarC5_1832
   HAT complexes
    Elongator complex
     MmarC5_1832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Radical_SAM_C Acetyltransf_1 Acetyltransf_10 Med16
Motif
Other DBs
NCBI-ProteinID: ABO36129
JGI: MmarC51832
UniProt: A4G0Z5
Position
1778789..1780414
Genome map
AA seq 541 aa AA seqDB search
MSDYSEFIRCIISNLLVEKEKIKDLDPKRKKQKVEDIKARCLRKFNLNVGFPPNSDIISQ
ASEEEKKELLPLLRKKPIRTLSGVAVVAVMTSPEPCPHGKCSFCPGGKESNFGDVPQSYT
GKEPATMRGVMYNFDPYVQTSERLSQLEKVGHPTDKVELIIMGGTFPARDIEYQENFIKR
CLDAMNGEVSETLEKAQEKNETAKHRCVALTLETRPDYCNEKEINEMLKLGTTRVELGIQ
STNDEVLEFVKRGHGTDASIKATQLLKDSGLKVSYHLIPGLPKTTPELDKETIKTVFENP
NFKPDLIKFYPCLVIPGTEVYELWQSGEFDPMTDEKAVDVITYGKSIMPKWVRTSRIQRD
IPVTVIDAGVKKSNLGELVYNNLEEKEIKCKCIRCREVGHVTYKKGIKPDLESITLCRED
YESSGGKEIFLSFEDTKNDLLIGYLRLRIPNNPFRKEITDKSALIRQVHVCGQQKELEGN
SKELSWQHKGYGRLLIDEAEKIAKEEFEKDQMLINSGIGVREYYKKLRYKRVGPYMGKNL
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgactattcagaatttatacgatgcatcatttctaatcttttagttgaaaaggaa
aaaataaaggatctggatccaaagaggaaaaaacaaaaggtagaggatatcaaggcgaga
tgtcttcgtaaatttaatttaaatgtgggattccctccaaattcagatattattagtcag
gcttcagaagaagaaaaaaaggaattacttccccttttaagaaaaaaaccaataagaaca
ctttcgggtgttgcagtagttgcagtgatgacttcacctgaaccctgtcctcatggaaaa
tgttcgttctgccctggcggaaaggaaagtaattttggagatgttccacagagttacact
ggaaaagaacctgcaacaatgcggggagtgatgtataactttgatccatacgttcagacc
agtgaaagactttcgcaacttgagaaagtaggtcacccgacagataaagtagaactgata
ataatgggtggaacttttcctgcaagagacattgaatatcaggaaaatttcataaaacga
tgtcttgatgcaatgaatggtgaagtttcagaaacacttgaaaaggcacaggaaaaaaac
gaaactgcaaagcacaggtgtgttgcacttactcttgaaacaaggcctgattactgcaac
gaaaaagaaatcaatgaaatgcttaaacttggaactacccgagtcgaacttggaattcaa
agcacaaatgacgaagttttagagtttgtaaaacgaggacacggaactgatgcatcaatt
aaagcaacccagcttttaaaagatagtggattaaaggtttcataccatttaatccctgga
cttccaaagacaactccagaactggataaagaaacaattaaaaccgtatttgaaaatcca
aacttcaaacctgacttgattaaattttatccctgcctcgtaattccaggaacagaagtc
tatgaattgtggcagagtggagaatttgatccaatgactgacgaaaaggcagtagatgtt
attacatatggaaaatcaatcatgccaaaatgggtcaggacctcaagaattcaaagagat
attcctgtaactgtaattgatgcaggcgttaagaaaagtaaccttggagagctcgtttat
aataatttggaagaaaaagaaataaaatgtaaatgtatacggtgcagagaagttggccat
gttacatacaaaaaaggaataaaacctgatttagaaagtattaccctatgcagggaagat
tatgaatcaagtggtggaaaagagatatttttatcgtttgaagacaccaaaaacgatctt
ttaattggatacttaagacttagaattccaaataatccatttagaaaagaaataaccgat
aaatctgcactcataaggcaggttcatgtttgcggacagcagaaagaactcgaaggtaat
tcaaaagaactttcatggcagcacaaaggttatggaagacttttaattgatgaagctgag
aaaattgcgaaagaagagttcgaaaaagaccagatgttgatcaacagtggaattggagtc
cgggaatactataaaaaactaaggtacaaaagagtaggtccgtacatgggcaaaaatctt
aaataa

DBGET integrated database retrieval system