KEGG   Maricaulis maris: Mmar10_0041Help
Entry
Mmar10_0041       CDS       T00394                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmr  Maricaulis maris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mmar10_0041
Enzymes [BR:mmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mmar10_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
43048..43785
Genome map
AA seq 245 aa AA seqDB search
MTVLVTRGWPGAERTASGLRQMGIDPIISPVLDINFRARIDASLDGVQALVFTSANGVRA
WGPRRPERDIQVFAVADATAQAARDIGFKRVHSAQGDVTSLANLIRRKLNPGKGSLLHVR
GIHVSGDLSGALKPDGFKVRDAIGYGAVAVDALGEEAIAAVISGAPVSVLIHSARGAKTF
LDLLRKFGLHHWLGSVTALGISRNALAPLEGAGFGALVAASVPNEEALLALLDDSSELAS
AGHAS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcctggtcacacgcggctggcccggtgctgaacggaccgcgtccggtctcagg
caaatgggtatcgatccgatcatctcgccggtactcgacatcaatttcagggcccgcatc
gatgccagcctcgacggggtgcaggcgctggtcttcacctcggccaacggtgtacgggcc
tgggggccgcgccgcccggaacgagatattcaggtcttcgctgtggccgacgccaccgcc
caggcagcgcgcgatatcgggttcaagcgcgtccattccgcccagggcgatgtcacatca
ctggccaatctcatccggcgaaagctcaatccgggcaagggttccctgctccacgtccgc
ggcatccatgtgtccggtgacctttcgggcgcgctcaagccggatggtttcaaggtccgc
gacgcgatcggctatggcgcagttgccgttgatgccctgggcgaggaggccatcgccgcc
gtgatctccggcgcgccggtctccgtcctgatccactcggcgcggggagccaaaaccttc
ctcgacctgctgcgcaaatttggtctgcatcactggctcggttcggtgactgcactgggt
atttcacgtaacgccctcgcgccactggaaggcgccggctttggagcgctggtcgctgca
tcggtgccaaatgaagaggccttgctggcgctgctggacgattcatcagaactggcctcg
gcaggccacgcgtcctaa

DBGET integrated database retrieval system