KEGG   Maricaulis maris: Mmar10_0090Help
Entry
Mmar10_0090       CDS       T00394                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmr  Maricaulis maris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmar10_0090
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmar10_0090
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmar10_0090
Enzymes [BR:mmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmar10_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(93760..94557)
Genome map
AA seq 265 aa AA seqDB search
MTNRLTTRFAELSAYNRAGFVAYMMAGDGDSQGLLDALPAAGADVIELGMPFTDPAADGP
AIQASALRALEAGMTLKGTLAQATEFRKQDKDTPLVLMGYANPIFSMGWEKFAKAAAKAG
VDGLICVDVPPEEDDELRTALTKQGIALIRLATPTTDDARLATVVANTAGFVYYVSTTGV
TGAGTGVVTEVGAAVDRVKAASGLPVAVGFGVREPEQAEAIAKRADAVVVGSAIVDAMHS
GGVAAATGLVKTLSSAVHAARRQDK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccgcctcactacccgtttcgcggagctgtccgcctataatcgtgccggattt
gtcgcctatatgatggctggcgacggtgacagccagggcttgctggatgcgctgccggct
gctggcgccgatgtgatcgagctgggcatgccctttaccgatccggcggctgacggcccg
gccatccaggcctcggcgctgcgggcgctggaggcggggatgacgctgaaaggcacgctc
gcccaggcgaccgagttccgcaaacaggacaaggacacgccgctggtcctgatgggctat
gccaatccgatcttctcgatgggttgggagaaatttgccaaggccgcggccaaggccggt
gttgacggtctgatctgtgtcgacgtgccgccggaggaagacgacgagctgcgcacggcc
ctcaccaagcagggcattgcgctgatccgcctggccacgcccaccaccgatgatgcgcgt
ctggcgaccgtggtcgccaatacggcgggcttcgtctattacgtttccacgacaggggtg
accggggccggaaccggcgtggtcaccgaggttggcgccgctgtcgaccgggtcaaggcc
gcttccggcctgccggttgcggtgggatttggcgttcgcgagcctgagcaggctgaagcg
atcgccaagcgggccgacgctgtcgtggtcggatcggccattgtcgacgccatgcattcg
ggcggcgtcgcggcggcgaccggcctggtgaagacattgtcgtcggcggtgcatgccgcc
cggcgccaggacaaatag

DBGET integrated database retrieval system