KEGG   Maricaulis maris: Mmar10_0093Help
Entry
Mmar10_0093       CDS       T00394                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmr  Maricaulis maris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmar10_0093
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmar10_0093
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmar10_0093
Enzymes [BR:mmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmar10_0093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(95696..96928)
Genome map
AA seq 410 aa AA seqDB search
MSETVSADTRPNALSAWPDARGHFGQFGGRFVAETLMPNILELEKAYAAAKTDPGFKAEM
DLFLKDYVGKPSPIYFAERLTEEFGGAKIWFKRDELNHTGSHKINNCLGQVLLAKRMGKT
RIIAETGAGQHGVATATVAARFGIPCTVFMGATDVERQAPNVFRMKLLGAEVIPVTAGTG
TLKDAMNEALRDWVTNVTDTFYVIGTVAGPHPYPAMVRDFQSIIGREARAQMMDRLGRLP
DACVACIGGGSNAMGLFHPFIEDEEVRLIGVEAAGLGVETGKHAASLKGGRPGILHGNKT
YLLQDDDGQIIDAHSISAGLDYPGIGPEHAFLHDMKRAEYVSATDEEAMEMFQLCTKLEG
IIPALEPAHALARVRDLAKELGPDGVILMNMCGRGDKDVPQVARMLGVEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgtctctgccgacacacgaccgaatgcgctgtcggcctggcccgacgca
cgtggccatttcggacaatttggcggtcgtttcgttgccgaaacgctgatgccgaacatt
ctcgagctggaaaaggcctatgcggcggcgaagacggatcccggcttcaaggccgagatg
gacctcttcctgaaggactatgtcggcaaaccgagcccgatctatttcgccgaacggctg
accgaggaatttggcggcgccaagatctggttcaagcgcgacgagctgaaccataccggc
agccacaagatcaataattgcctcggccaggtcctcctggccaagcgcatgggcaagacc
cgcatcatcgccgagaccggcgccggccagcatggcgtggcgacggcgacggtggcggcg
cgcttcggtattccctgcaccgtcttcatgggcgccaccgatgtcgagcgccaggcgccc
aatgtcttccgcatgaagctgctgggcgccgaggtgatcccggtcacggccggcaccggc
acgctcaaggacgccatgaatgaagcgctgcgggactgggtcaccaatgtcaccgacact
ttctacgtcatcggcacggtcgccggtccgcacccctatccggccatggtgcgcgacttc
cagtcgatcatcggccgcgaggcccgggcccagatgatggaccgactgggccgcctcccg
gacgcctgtgtggcttgtatcggtggcggctcgaacgcgatggggctgttccatcccttc
atcgaggatgaggaggttcgcctgatcggggtcgaggccgcgggcctaggcgtcgagacc
ggcaagcatgccgcctccctgaagggcggacggcccggcatcctgcacggcaacaagacc
tatctgctgcaggatgatgacggccagatcatcgacgcccactcgatctctgccggcctc
gactatcccggcatcggcccggagcatgccttcctgcacgacatgaagcgcgccgaatac
gtctccgccaccgatgaggaagcgatggagatgttccagctctgcaccaagctggagggc
atcatcccggccctggaacccgcccacgccctcgcccgcgtccgcgacctcgccaaggag
ctcggcccggacggcgtcatcctgatgaatatgtgcggccgcggcgacaaggacgtgccg
caagtcgcgcgcatgctgggggtggagttgtag

DBGET integrated database retrieval system