KEGG   Maricaulis maris: Mmar10_0162Help
Entry
Mmar10_0162       CDS       T00394                                 

Definition
restriction modification system DNA specificity subunit
Orthology
K01154  
type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
mmr  Maricaulis maris
Brite
Enzymes [BR:mmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     Mmar10_0162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
169145..170296
Genome map
AA seq 383 aa AA seqDB search
MSPTIALGDIVKLRKGRKAQEVLSAAAAGALPYIQIDEVRGVAPTKYAKDPSAVDVGPDD
LCIVWDGANAGTVGYGLSGAIGSTVARIRFSDHGQWDAAFVGRLLQGKFRQLNDQAQARG
ATIPHVDKSKLEQLAIPRIDLDEQRRIAAILDKADAIRRKREEALALADDFLKSTFLEMF
GDPLAPEPHGSISTIDTECDLFAGNSLPRGEEFRGQDRGCLLLKVSDLNSEGNETQIVSS
KLWVPPNEKLRASMVAPAGSIVFPKRGGAISTNKKRVLSRPAVLDPNLMGVAPKSGSSIS
FRYLRNWFELLDLVTISSGSTVPQLNKKDVGPLRIVVPTPVDLERFDNIYERSAKLREKL
RSAWDSSAHLFASLSQRAFRGEL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagccccacaattgcgctcggcgatattgtcaaactccgtaaaggccggaaggcgcag
gaagttctttctgccgcagctgccggcgcgctcccgtatatccagattgacgaggtaaga
ggggtagcgcccacgaaatacgcaaaagatcctagcgcggtagacgtcggcccagacgac
ctttgtattgtttgggacggagcaaatgcgggtacggttggttatgggctcagcggcgca
attgggagcactgttgcccgcattcgcttttcagatcacggccaatgggatgctgcattt
gttggtcgcctgctccaaggaaaatttcgacagcttaacgatcaggctcaagcgcgaggc
gcgaccatccctcacgtggacaagtctaagctcgaacagctcgctattccgcgcattgat
ttggatgaacaacgccggatcgcggcgatcctggacaaggcggatgcgatccgccgcaag
cgcgaagaggccctcgccctcgccgacgacttcctgaaatcgaccttcttagagatgttt
ggtgatccgcttgcgccggagccgcacggtagtatcagcacgatcgacacagagtgcgat
ttgtttgccggaaactctctgccaagaggcgaggaattcagaggacaagaccgtgggtgt
ctacttttgaaggtttcagacctcaattcagaggggaatgaaactcaaattgtttcatca
aagctttgggtgccaccaaacgaaaaattgcgcgccagtatggttgcacccgctggatca
attgtttttcccaagaggggaggggctatatcaaccaataagaagcgcgttcttagccgc
cccgctgttctagaccctaacctaatgggggtcgcacccaaatctggctcctcaatttcg
tttcgctaccttcgaaactggtttgaactcctggacttggtgacgatatcaagcgggagt
accgtgccccaattgaacaagaaagacgtggggccattaaggattgttgtcccgacacct
gtcgatctggagcgtttcgacaacatctatgagcggtccgcgaaattgcgggagaagctg
cggtcggcgtgggatagctcagcgcaccttttcgcctccctctcccagcgcgcattccgg
ggcgaattgtga

DBGET integrated database retrieval system