KEGG   Maricaulis maris: Mmar10_0437Help
Entry
Mmar10_0437       CDS       T00394                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mmr  Maricaulis maris
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mmar10_0437
DNA repair and recombination proteins [BR:mmr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mmar10_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
514746..515351
Genome map
AA seq 201 aa AA seqDB search
MKTASAGPEIERLISLLAKLPGLGPRSARRAALNLLGKKDALMRPLAEALADAADKIRAC
SECGNMDVSDPCTVCAAPNRLDAAICVVETVGDLWALERAGAFKGRYHVLGGVLSALDGV
RPEDLNITKLVERSAREEVSEIVLALNATVDGQTTAHYLADRMAGCNVSITSLARGVPVG
GELDYLDDGTLAAAFRSRSTV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagcctcggccggtcccgaaatcgaacgcctgatatcgctgctcgccaagctg
ccaggcctcggcccgcgctcggctcgacgggcggcgctgaacctgcttggcaagaaggac
gcgctgatgcgtccgcttgccgaagccctggccgatgcggccgacaagatccgggcctgc
agcgagtgtggtaatatggatgtctccgatccgtgcacggtctgcgccgcgccgaaccgg
ctcgatgcggccatctgtgtggtcgagaccgtcggcgatttgtgggcgctggaacgagcc
ggtgccttcaaggggcgctatcatgttcttggcggcgtcctgtcggcactggacggtgtg
cggcctgaagatctcaacatcaccaagctggtcgaacggtccgcccgtgaagaggtgagc
gagatcgtgctggcgctcaatgccacggtcgatggacagacaactgcgcactatctcgcc
gaccgcatggccgggtgcaatgtctcgattacctcgctggcgcggggcgtcccggtcggt
ggtgaactggactatcttgatgacggaacgctggcggcggcctttcgcagccggtccacc
gtctga

DBGET integrated database retrieval system