KEGG   Maricaulis maris: Mmar10_0543Help
Entry
Mmar10_0543       CDS       T00394                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase, NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mmr  Maricaulis maris
Pathway
mmr00071  Fatty acid degradation
mmr00280  Valine, leucine and isoleucine degradation
mmr00281  Geraniol degradation
mmr00310  Lysine degradation
mmr00362  Benzoate degradation
mmr00380  Tryptophan metabolism
mmr00410  beta-Alanine metabolism
mmr00640  Propanoate metabolism
mmr00650  Butanoate metabolism
mmr00903  Limonene and pinene degradation
mmr00930  Caprolactam degradation
mmr01040  Biosynthesis of unsaturated fatty acids
mmr01100  Metabolic pathways
mmr01110  Biosynthesis of secondary metabolites
mmr01120  Microbial metabolism in diverse environments
mmr01130  Biosynthesis of antibiotics
mmr01200  Carbon metabolism
mmr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mmar10_0543
   00650 Butanoate metabolism
    Mmar10_0543
  Lipid metabolism
   00071 Fatty acid degradation
    Mmar10_0543
   01040 Biosynthesis of unsaturated fatty acids
    Mmar10_0543
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mmar10_0543
   00310 Lysine degradation
    Mmar10_0543
   00380 Tryptophan metabolism
    Mmar10_0543
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mmar10_0543
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mmar10_0543
   00281 Geraniol degradation
    Mmar10_0543
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmar10_0543
   00930 Caprolactam degradation
    Mmar10_0543
Enzymes [BR:mmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mmar10_0543
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mmar10_0543
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mmar10_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH GIDA UDPG_MGDP_dh_N F420_oxidored NAD_binding_2 DAO Sacchrp_dh_NADP Pyr_redox_2 FAD_binding_3 NAD_binding_7 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABI64836
JGI: Mmar100543
UniProt: Q0ASA1
Position
634573..636783
Genome map
AA seq 736 aa AA seqDB search
MKNFTLEIDSDGIALVTFDSPGKSMNVISADVMDDFDALTGKIINDDAIKGVVITSGKAA
FCAGADLSELGGSSAALAKLPEEEMKTKLFEQCFRLNKTFRALETCGKPIAAAVNGLALG
GGFEIALACHYRVMPSDNPKAKLGLPEAMVGVLPGGGGTQRLPRLVGLMNAAPILLQGKQ
LDAAAAQAQGIVDAVVPGGELVAKAKELVKEDPKSAKQPWDGDKFRFPGGGPYHPAGAQM
FGAASPMLRKTSYGNYPAQRYILSCVYEGSQVSMDAALRIESRYFTKLLLRPESRNMIRS
IFLSKQDLDKGGRRPAGQDKGEINKIAIIGAGFMGAGIATVSAQAGIEIVLIDATQEGAD
KGKKHCTDHFAKGVARGKLSQDKADKLGALITPTTDYTLIKDVDLVVEAVFENSELKAKI
TKMAEEQIGTTAVFGSNTSSIPITDLAKASDRPDNFIGIHFFSPVEKMNLVEIIMGEKTG
DYALSRTIDFVTKIKKTPIVVSDTRGFYANRCVMRYIGEGMNLLAEGVKPALIENAARMA
GMPVGPLSLQDEVALDLGVKLIKQTKADLGDTHKPSKTEPILFKMVEEYERFGRKNAKGF
YDYPAEKGQPKRLWPELEQFAPGGKYAADQPTADEIKDRILYAQALEAARCMGEDIVQDP
READVGSILGWGFAPYTGGTLSYIDTIGAKAFVARAKELEAAYGDQFAVPDLLVEMAEKG
ETFYGRFGAPAAVAAE
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttcacacttgaaatcgattccgacggcattgccctggtcacctttgacagc
ccgggcaagtcgatgaacgtcatctcggccgatgtcatggatgacttcgacgcgctgacc
ggcaagatcatcaatgacgacgccatcaagggcgtggtcatcacctcgggcaaggcggcc
ttctgtgccggcgccgacctgtcggaactgggcggctcgtctgcggcgctggccaagctg
ccggaagaggaaatgaagacgaagctgttcgagcaatgcttccgtctcaacaagaccttc
cgcgccctggaaacctgcggcaagccgatcgctgcggcggtcaacggcctcgccctgggc
ggtggcttcgagattgccctggcctgtcactaccgcgtcatgccgtcggacaatcccaag
gccaagctcggcctgccggaagccatggtcggcgtgttgccgggcggtggtggaacccag
cgactgccgcgcctggtgggtctgatgaatgccgcaccgatcctgctgcagggcaagcag
ctcgacgccgctgccgcgcaggcccagggtattgttgatgccgtggtgccgggtggcgag
ctggtggccaaggccaaggaattggtcaaggaagaccccaagtctgccaaacagccctgg
gatggcgacaagttccgcttccccggtggtggcccttaccaccccgccggtgcccagatg
ttcggtgccgcctcgccgatgctgcgcaagaccagctatggcaattacccggcccagcgt
tacatcctgtcctgcgtctatgaaggctcgcaggtctcgatggatgccgcgctgcgcatt
gaaagccggtatttcaccaagcttttgctgcgcccggaaagccgcaacatgatccgctcg
atcttcctgtccaagcaggacctggacaagggcggacgccgtccggccggtcaggacaag
ggcgagatcaacaagatcgccatcatcggtgccggtttcatgggcgcgggcattgccacg
gtttcggcccaggccgggatcgagattgttctcatcgacgccacgcaagagggcgccgac
aagggcaagaagcattgtaccgatcacttcgccaagggcgtcgcccgcggcaagctgagc
caggacaaggctgacaagctgggcgccctgatcacgccgaccaccgactacaccctgatc
aaggatgtcgatctggtcgtcgaggccgtgttcgagaattccgaactcaaggccaagatc
accaagatggcggaagagcagatcggcaccacggcggtgtttggctcgaacacctcctcc
atcccgatcaccgatctcgccaaggcgtcggatcgtccggacaatttcatcggcatccac
ttcttctcgccggtcgagaagatgaacctggtcgagatcatcatgggcgagaagacgggc
gattatgccctctcgcgcacgatcgatttcgtcaccaagatcaagaagacgccgatcgtc
gtctccgacacgcggggcttctacgccaatcgctgcgtcatgcgttatatcggtgagggc
atgaacctcctcgccgagggcgtgaagccggccctgatcgagaatgccgccaggatggcc
ggcatgccggtcggtccgctctccctgcaggacgaggtggcgctggatctcggcgtgaag
ctgatcaagcagaccaaggccgatctgggtgacacgcacaagccgtccaagaccgagccg
atcctgttcaagatggtcgaggaatatgagcgcttcggtcgcaagaatgccaagggcttc
tacgactacccggccgagaagggtcagcccaagcgtctctggccggagctggagcagttc
gctccgggtggcaagtacgccgccgaccagccgacagccgacgagatcaaggaccgcatc
ctctacgcccaggcgctggaagcggcgcgttgcatgggtgaggacatcgtccaggatcca
cgcgaggccgatgtcggctcgatcctcggttggggtttcgcgccctataccggcggcacg
ctgtcctacatcgacaccatcggcgccaaggccttcgtggcccgcgccaaagagctggaa
gccgcctatggcgaccagttcgcggtaccggacctcctcgtcgaaatggccgagaagggc
gaaaccttctacggacgcttcggcgccccggcggcggtggcggcggagtaa

DBGET integrated database retrieval system