KEGG   Maricaulis maris: Mmar10_0601Help
Entry
Mmar10_0601       CDS       T00394                                 

Definition
Beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mmr  Maricaulis maris
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mmr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mmr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
696098..697243
Genome map
AA seq 381 aa AA seqDB search
MFGAGKTSDGKRIMDRRRVLKSGIAATLTAAFGPAAGALVREAMERPLAERVGDMLLMGF
IGSHSETEGADIIDAHLAAKRIGGVLFLRHNVRSREGAEGSAARFRATSPSSWMAIDQEG
GLVQRLSRDLGYTHIPRAMQVAEARSPESAGDLYRLGAAEFHAAGFNMNLAPVADLHDPD
NAVIGRHGRAYGADGETIAAYAGAFIDAFEAFGIACAIKHFPGHGRSRGDSHDGFVDISD
SWSEAELAPFRQLIERGQAHVMMGGHLTNRQLDPTGAPVTFSAPVLEGLLRDQLGFTGVM
MTDDLDMGAIRNNYSQHEAVISAIEAGNDMIMLSNSAAPDAELPQRIVGWVEAAISEGRL
TEHRINQSVARLAVLKARVGL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttcggtgcggggaaaacgagtgacggaaagcgtatcatggatcgacggcgcgtcttg
aaatcgggtatcgcggccacactgacggcggcgtttgggccggctgccggtgccctggtc
cgcgaagccatggaacggcccctggccgagcgcgtcggcgacatgttgctgatgggcttt
atcggctcgcattcggagacggaaggtgccgacatcatcgacgcccatctggcggccaag
cggatcggcggcgtgctcttcctgcgccataatgtgcgctcacgtgagggtgctgaggga
tccgcggcccgttttcgcgctacaagcccgtcatcctggatggctatcgatcaggaaggc
ggtctggtccagcgcctgtcgcgtgatctgggctacacccatattccgcgggccatgcag
gtcgccgaagcccgctcacccgaatccgcaggcgatctctatcggctcggcgccgccgag
tttcacgccgccggcttcaacatgaatctggcgccggttgccgacctccacgatcccgac
aatgcggtgatcggtcggcacgggcgggcctatggcgcggatggcgagaccatcgccgcc
tatgccggtgccttcatcgacgctttcgaggcctttggcatcgcctgcgcgatcaagcac
ttccccggacatggccggtcgcgcggtgacagtcatgacggttttgtcgatatttccgac
agctggagcgaggccgagctggcgcctttccgccagttgatcgagcggggtcaggcgcat
gtcatgatgggcgggcacctgaccaatcggcagctcgacccgaccggcgcgccggtgacc
ttctcggcaccggtattggaaggcctcttgcgcgatcagctcggcttcaccggcgtgatg
atgacggatgatctcgacatgggcgcgatccgcaataattacagccagcacgaggcggtg
atcagcgccatcgaggccggcaatgacatgatcatgctgtccaactccgccgcccccgat
gccgaactcccgcaacgcattgtcggctgggtagaggcggccatcagcgagggtcggctg
accgaacaccggatcaaccagtcggtcgcccgcctggccgtgctgaaggcgcgggtgggg
ctctag

DBGET integrated database retrieval system