KEGG   Maricaulis maris: Mmar10_0661Help
Entry
Mmar10_0661       CDS       T00394                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mmr  Maricaulis maris
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mmar10_0661
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mmar10_0661
Enzymes [BR:mmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mmar10_0661
Two-component system [BR:mmr02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mmar10_0661
Bacterial motility proteins [BR:mmr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mmar10_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
759367..760572
Genome map
AA seq 401 aa AA seqDB search
MTELAPKASPAHSIARVLVIDDSAVARGLMTRWVEEDSDLTLIGSAVDGEQGLRKAEELK
PDLIVLDVEMPKMDGLAALPLLLKAVPGCKIVMASTLTRRGGEVTIRALSMGAADYASKP
QAGRLAGAEEFRRDLLLKLKALAPRPIPPVPTQRDMAPSPAPATPAAPGAPVARSITPPP
PPSSSAPAKKAFAPVAQPPQGRGTPRNTARPEIIAIGSSTGGPQALRDVIAAFPADVRSP
IVIAQHMPALFTKILAEHLTKAGKLVCKEAEDNERLKPGCVYIAPGDFHMTIRKDAAGFY
AVLDQTPPINFCRPAVDPLFQSVAEVTRGAALGIVLTGMGHDGREGARMLRSVGGTILAQ
DEATSVVWGMPGAVAEAGLADEILSLADMGPGIVRRAKGGN
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacggaactcgcccccaaggcgtctcccgcccactctatagcccgggtcctggtgatc
gatgactcggctgtcgcccgcggtctcatgacgcgctgggtggaagaggattccgatctc
accctcatcggctcggccgttgacggcgagcaaggcctgaggaaagccgaagagctcaag
ccggacctgatcgttctcgacgtcgaaatgccgaagatggacgggctggcggcgttgccg
ctgctgctcaaggctgtgcccggttgcaagatcgtcatggcctcgacgctgacccgccgc
ggcggtgaagtgacgatccgtgccctgtcgatgggcgcggccgactatgcctccaagccg
caggccggacgcctggctggtgccgaggagttccgccgcgacctgctgttgaagctgaaa
gccctggctccgcgcccgattccgccggtgccgacacagcgagacatggcgccatctccc
gcaccagcaacaccggctgcgccgggagcaccggttgcccggtcgatcacgccgccaccg
ccaccttcctcgtctgcgcctgcgaagaaggccttcgcgcctgtggcacagccgccgcag
ggtcgcggcacgccgcgaaacacggcccgacccgagatcatcgcgatcggctcgtcgacc
ggtggaccgcaggccttgcgtgatgtgattgccgcctttcctgccgacgtccgttcgccg
atcgtgatcgcccagcacatgccggcgctgttcaccaagatcctggccgaacacctgacc
aaggctggcaagctggtctgcaaggaagcggaagacaatgaacgactgaagccgggctgc
gtctatatcgctccgggtgacttccacatgaccatccgcaaggacgcggccggtttctat
gcggtgctcgatcagacgccgccgatcaacttttgccgtccggccgttgacccgctgttc
cagtcggtggcggaagtcacacggggtgccgccctgggcatcgtgctgaccggcatgggc
catgatggccgcgaaggcgcgcgcatgttgcgcagtgtcggcggcaccatcctcgcccag
gacgaggcgacaagcgttgtctggggcatgccgggagccgtcgcagaagcgggcctggcc
gatgaaatcctgtccctcgcggacatggggccgggcattgtccggcgcgcgaaaggtgga
aactaa

DBGET integrated database retrieval system