KEGG   Maricaulis maris: Mmar10_0826Help
Entry
Mmar10_0826       CDS       T00394                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mmr  Maricaulis maris
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mmar10_0826
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mmar10_0826
Enzymes [BR:mmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Mmar10_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(917883..918683)
Genome map
AA seq 266 aa AA seqDB search
MSSIRTDLTGQVAIITGSTSGIGAAMAEALAANGCHIILNGLGDASEIESLRAKIASDHG
VEVRYHPANMLKPDEIADMVASAEREFGRLDILLSNAGIQHVSPVEDFPAEKWDAIIAIN
LTSVFHAAKAAIPVMKRQGKGRIVNLASAHGLVASPFKSAYVAAKHGVMGFTKTLGLELA
EDGITCNAICPGYVKTPLVENQIADTAKARGITEDEVVRDVMLAAQPTKKFVTYEQLAGA
LLYLVSDAGANMNGSWISVDGGWTAK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccattcgcactgatctcacgggccaggtggccattattaccggctcgacgagc
gggattggggcggcgatggcggaggcgttggcggccaatggctgtcacatcattctcaac
gggctgggtgatgcgagcgagatcgagagcctgcgagccaagatcgccagcgatcatggg
gtcgaggtgcgctaccatccggccaatatgctcaagccggacgagatcgccgacatggtt
gcctcggccgagcgtgaattcgggcgcctggacatcctcctgtccaatgccggcatccag
cacgtctcgccggtcgaggatttcccggccgagaaatgggacgccatcatcgccatcaac
ctgacctcggtcttccatgcggccaaggcggcgatcccggtcatgaagcgccagggaaaa
ggccggatcgtcaatctcgcctcggcccacggtctggtcgcctcgccgttcaaatcggcc
tatgtcgcggccaagcatggggtgatgggtttcaccaagactttgggcctggagctggcc
gaggatggcatcacctgcaatgcgatctgtccgggctatgtgaagacgccgctggtggaa
aaccagatcgccgacacggccaaggcgcgcgggattaccgaggatgaagtcgtgcgcgat
gtcatgctggcggcccagccgaccaaaaaattcgtcacctatgagcagctcgccggcgct
ttgctctatcttgtctccgatgccggggccaatatgaatggttcctggatcagcgtagac
ggcggatggacagccaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system