KEGG   Maricaulis maris: Mmar10_1228Help
Entry
Mmar10_1228       CDS       T00394                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mmr  Maricaulis maris
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mmar10_1228
   00240 Pyrimidine metabolism
    Mmar10_1228
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Mmar10_1228
   03430 Mismatch repair
    Mmar10_1228
   03440 Homologous recombination
    Mmar10_1228
Enzymes [BR:mmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Mmar10_1228
DNA replication proteins [BR:mmr03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Mmar10_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1339505..1339957
Genome map
AA seq 150 aa AA seqDB search
MSGDLWFYHLERSSLDEVLPELLEKTLARGWRALVRSPDAKRREAIDQLLWTWREDSFLP
HGQVEAGSPERQPVLIAEDEANPNGAHCLFLLDGAEPEKPSSFDRMIVMFDGQDEMAVTD
ARALWKKASAEGCTVSYWRQSPEGRWEKKA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgatctctggttctatcatctcgagcgctcctcgctggacgaggtcctgccc
gagctgctggaaaagacactggcgcgcggctggcgggcgctggtgcgttcgcccgatgcc
aagcgccgcgaggcgatcgaccagctcttgtggacctggcgcgaggactcattcctgccg
catggccaggtcgaggccggttcgcctgagcgccagccggtcctcattgccgaggacgaa
gccaatccgaacggggctcattgtcttttcctgctcgatggcgccgagcccgaaaaaccg
tcatcctttgaccgcatgattgtcatgtttgacgggcaggacgaaatggcggtgaccgac
gcgcgcgcgctgtggaagaaagcctcggctgagggctgtacggtatcctactggcgccag
tcgccggaaggccgatgggagaagaaggcatga

DBGET integrated database retrieval system