KEGG   Maricaulis maris: Mmar10_1323Help
Entry
Mmar10_1323       CDS       T00394                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mmr  Maricaulis maris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1441345..1442397)
Genome map
AA seq 350 aa AA seqDB search
MNGRLLGKEGREFALKALDLMDQFGVAPTPENYSVWVCFASDTNPELCETLKNHIESGGD
FSETVNNELFEQYFQWKAIQDAILESGGVMCRELGAVQETLEAAERDTAAYGKALEGASH
ELTATPDAPGMKKLVESLVSATARMQRRSQALEDRLQATSNEVTQLRTNLEKVREEAMTD
ALTGIANRKRFDESLRRARRDADTKKQPLSLILCDIDFFKRFNDTWGHQTGDQIIRFVAG
CLTRHAGENHLVARYGGEEFGIVMPNTAPNVAEQVAEKIRKTVESKKLLRKSTNEDLGNI
TVSLGIATYHEGESIEELIERSDTNLYRSKTEGRNRTTVDNSRAPSRSAA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggtcgactgcttggcaaagaaggacgtgagttcgcgctcaaggcgctggatctc
atggatcaattcggcgtagcgccgaccccggaaaactattccgtgtgggtctgcttcgcc
agcgacaccaatccagagctttgtgaaacactcaagaaccacatcgaatcgggcggcgat
ttctcggaaaccgtcaacaacgaattgttcgaacagtacttccagtggaaagccatccag
gatgctattctggaaagcggcggcgtcatgtgccgcgaacttggcgctgttcaggaaaca
cttgaagcggccgagcgcgacaccgctgcctatgggaaagctctggaaggtgcgagccac
gagctgaccgcaactccggacgcaccgggcatgaaaaaacttgtcgagagccttgtctca
gcgaccgcccgcatgcagcgtcgcagccaggccctcgaggaccgcttgcaggcgacctcg
aacgaagtcacccagcttcggaccaatctggaaaaagtccgtgaagaagcgatgacggat
gccctcaccggcattgccaatcgcaagcgttttgacgaatccctgcgccgcgcccgccgc
gacgcggataccaagaaacagccgctcagcctgattctttgcgatatcgatttcttcaag
cgcttcaacgacacctggggccatcagaccggcgaccagattattcgctttgtagccggc
tgcctgacccgacatgctggcgaaaatcaccttgtcgcccgatatggtggtgaggagttt
ggaatcgtgatgccgaacaccgcaccgaatgtcgccgaacaggttgccgaaaaaattcgc
aagaccgttgagtcgaaaaaacttcttcgcaaatcgaccaatgaagacttgggcaatatc
accgtttctctcgggatcgcgacctatcacgaaggcgaatcgatcgaggaactgattgaa
cgctcggacaccaatctttaccgatccaagaccgaagggcgcaaccggaccacggtcgac
aacagccgcgccccgtctcgcagcgcggcctga

DBGET integrated database retrieval system