KEGG   Maricaulis maris: Mmar10_1405Help
Entry
Mmar10_1405       CDS       T00394                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmr  Maricaulis maris
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmar10_1405
   01230 Biosynthesis of amino acids
    Mmar10_1405
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmar10_1405
   00051 Fructose and mannose metabolism
    Mmar10_1405
   00562 Inositol phosphate metabolism
    Mmar10_1405
Enzymes [BR:mmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mmar10_1405
Exosome [BR:mmr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mmar10_1405
  Exosomal proteins of bladder cancer cells
   Mmar10_1405
  Exosomal proteins of melanoma cells
   Mmar10_1405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1541750..1542520
Genome map
AA seq 256 aa AA seqDB search
MADRGGWMSRRKLIAGNWKMNGLSGALGYFSELAPVAAGASADVLVCPPATLIHAAVQAC
AGTGIRVGGQDCHAQDHGAYTGDISAAMLRDCGATHVILGHSERRAAHGETDGDVRAKAV
AALAAGLVPVICVGETLAEREAGRAVEVVARQLAGSLPENSAILDLVIAYEPVWAIGTGR
TASAADVAAMHAAIRERLPDPLTTCILYGGSVKPGNARELLSLADVDGALVGGASLDAAD
FSAIIEAVSLENEPLR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcggggaggctggatgtcgcggcgcaaacttattgcaggcaattggaaaatg
aacgggctttcgggcgcgctcggctatttttcggaactcgcgcccgtcgcggccggagca
tcagctgatgtgctggtctgtccgcccgcgaccctgatccatgctgccgttcaggcctgc
gccggaaccggtatccgtgtcggtggccaggattgtcacgcccaggaccatggcgcctac
acgggtgatatttcggccgccatgctgcgggattgcggcgccactcatgtgatccttggc
cattccgaacgccgcgccgcccatggtgaaaccgacggggatgtccgcgccaaggcagtt
gccgcccttgccgctggcctggtgccggtgatctgtgtcggcgaaaccttggccgagcgt
gaagccggccgggcggtcgaggtggtggcccgccagctggctggatcacttccggaaaat
tctgcaatcctggatttagtcatagcttatgagccggtctgggccatcggcaccggacgg
acggcctcggcggccgatgtggcagccatgcatgcggccatccgagaacgcctgccagat
cctctaaccacttgtattctttatggtggttcggtgaagccgggcaatgctcgggagcta
ttgtcactggccgatgtggatggggccctggtcggtggtgcgagcctcgatgcggctgat
ttcagtgcgataatcgaggccgtcagtctggagaatgaacctcttcggtaa

DBGET integrated database retrieval system