KEGG   Maricaulis maris: Mmar10_1420Help
Entry
Mmar10_1420       CDS       T00394                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mmr  Maricaulis maris
Pathway
mmr00010  Glycolysis / Gluconeogenesis
mmr00020  Citrate cycle (TCA cycle)
mmr00620  Pyruvate metabolism
mmr01100  Metabolic pathways
mmr01110  Biosynthesis of secondary metabolites
mmr01120  Microbial metabolism in diverse environments
mmr01130  Biosynthesis of antibiotics
mmr01200  Carbon metabolism
Module
mmr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmar10_1420
   00020 Citrate cycle (TCA cycle)
    Mmar10_1420
   00620 Pyruvate metabolism
    Mmar10_1420
Enzymes [BR:mmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mmar10_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABI65712
JGI: Mmar101420
UniProt: Q0APS5
Position
1556145..1557467
Genome map
AA seq 440 aa AA seqDB search
MSIEILMPALSPTMEEGTLAKWHVKEGDVVESGMVLAEIETDKATMEVEAVDEGTVGKIL
VEDGTEGVKVNAVIAILLEEGETEVSAPTPAAPAPSVSSADTSPASGGEKSELVSAPASG
GSGSAKGGDEGGAAKGGDNRIKASPLAKRIAADKGLDLKTIDGSGPYGRIVKRDVENAQP
SAATSASASEAPAAAPVDMDDPLKAYGIARDRYDVEKADGITKISAKRLSESFRDIPHFP
LTVDCRIDALMDFRKRINAAAEKDGDKVSVNDILIKASGLALKKVPAANSSWIEGGMIAR
HKHADVSMAVAIEGGLITPIIADADQKGLVEISRQSKDLATRARDRKLKPEEFQGGTFSL
SNLGMFGIDSFASIINPPQGMILSVGAGEQRPVVKDGALAIAMVMTVTLTCDHRVVDGAT
GAKWLQAFKTYVEDPMTMLM
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatagaaatcctgatgcccgccctgtcgcccaccatggaagagggcacgctcgcc
aaatggcacgtcaaggaaggcgatgtcgtggaaagcggcatggtcctggccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgatgaaggcacggtcggcaagatcctg
gtcgaggacggcactgagggcgtcaaggtcaacgccgtgatcgccatccttctcgaagag
ggtgagacggaagtgtctgccccgacgcctgcggcgccggccccctccgtcagctccgct
gacacctcccccgcaagcggtggagaaaaatccgagcttgtttctgcccccgcgagcggg
ggaagtggctccgccaaaggcggagacgaagggggcgccgccaagggcggcgataaccgc
atcaaggccagcccgctggccaagcgcatcgccgccgacaagggtctggatctcaaaacc
attgacggatcaggtccctatggccggatcgtcaagcgcgatgtcgagaacgcccaaccg
tctgccgcgacctctgccagcgccagcgaagcgccggccgccgcaccggtcgacatggat
gatccgctcaaggcctatggcattgcccgcgatcgctatgacgtcgagaaggccgacggg
atcaccaagatctccgccaagcgcctgtcggaaagcttccgtgacatcccgcatttcccg
ctgacggtcgattgccgcatcgacgcgttgatggatttccgcaagcgcatcaatgccgcc
gccgagaaggatggcgacaaggtctcggtcaatgacatcctgatcaaggcgtcaggcctg
gcgctgaagaaggtacccgcggccaactcgtcctggattgagggcggcatgatcgcccgc
cacaagcacgccgatgtctccatggccgtggccattgaaggcgggctgatcacgccgatc
atcgccgatgcggatcaaaagggtctggtcgagatctcgcgccagtccaaggatctcgcc
acgcgcgcccgcgatcgcaagctgaagccggaagaattccagggcggcactttctccctg
tccaatctgggcatgttcggtatcgacagcttcgcctccatcatcaatccaccccagggc
atgatcctgtcggtcggggctggagagcagcgcccggtcgtcaaggacggcgccctggcc
attgccatggtgatgacggtgacgctgacctgcgaccaccgtgtcgtcgacggtgccaca
ggcgcgaaatggctgcaggccttcaagacctatgtcgaagacccgatgacgatgctgatg
tag

DBGET integrated database retrieval system