KEGG   Maricaulis maris: Mmar10_1543Help
Entry
Mmar10_1543       CDS       T00394                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmr  Maricaulis maris
Pathway
mmr00071  Fatty acid degradation
mmr00280  Valine, leucine and isoleucine degradation
mmr00281  Geraniol degradation
mmr00310  Lysine degradation
mmr00360  Phenylalanine metabolism
mmr00362  Benzoate degradation
mmr00380  Tryptophan metabolism
mmr00410  beta-Alanine metabolism
mmr00627  Aminobenzoate degradation
mmr00640  Propanoate metabolism
mmr00650  Butanoate metabolism
mmr00903  Limonene and pinene degradation
mmr00930  Caprolactam degradation
mmr01100  Metabolic pathways
mmr01110  Biosynthesis of secondary metabolites
mmr01120  Microbial metabolism in diverse environments
mmr01130  Biosynthesis of antibiotics
mmr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mmar10_1543
   00650 Butanoate metabolism
    Mmar10_1543
  Lipid metabolism
   00071 Fatty acid degradation
    Mmar10_1543
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mmar10_1543
   00310 Lysine degradation
    Mmar10_1543
   00360 Phenylalanine metabolism
    Mmar10_1543
   00380 Tryptophan metabolism
    Mmar10_1543
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mmar10_1543
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mmar10_1543
   00281 Geraniol degradation
    Mmar10_1543
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmar10_1543
   00627 Aminobenzoate degradation
    Mmar10_1543
   00930 Caprolactam degradation
    Mmar10_1543
Enzymes [BR:mmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mmar10_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ABI65835
JGI: Mmar101543
UniProt: Q0APF2
Position
complement(1692798..1693865)
Genome map
AA seq 355 aa AA seqDB search
MTETQSQDPEIIARKIGRIGRITLNRPKALNALTHGMCLAMIEALQAWRNDDEVQVIVVD
GAGEKGFCAGGDILQLHNSGKAGDDKAWLFWRDEYQLNTLIHHYPKPYVALIDGITMGGG
VGVSVHGSHRVAGDRTMLAMPETGIGFHPDVGGAYFLPRLAGEIGTWMGLTGARLKAPDC
VAAGLATHYCPSGQYDALIEALESADLTGEDALEVLLEEFSGDPGDSDLSVTGGLIDAAF
AGDSVDDILARIEAAGDPWSAKQAKILGTKSPTALKLTLACLRKGADLSFEDVMRQDLRV
SSWCLTGTDFYEGVRAVIIDKDQAPKWAPAAADSEIEKAFAPLDAAHEMSFLDEA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaacccaatcccaagacccagaaatcatcgcccgcaagatcggccggatcggc
cgtatcacgctcaaccggcccaaggcgctcaatgcgctgacccatggcatgtgcctcgcc
atgatcgaggcgctgcaggcctggcggaatgatgatgaggttcaggtcatcgtcgttgac
ggggctggcgagaaggggttttgcgctggcggggatattctccagttgcacaattccggc
aaggcgggtgacgacaaggcctggctgttctggcgcgatgagtaccagctcaacacgctg
atccatcactatcccaaaccctatgtcgccctgattgacggcatcaccatgggcggcggt
gtgggtgtgtcggtgcatggttcgcaccgggttgccggcgaccggacgatgctggccatg
ccggaaaccgggatcggctttcacccggatgtcggcggcgcctatttcctgccgcgcctg
gctggcgagatcggtacctggatgggcctgaccggcgcccggctgaaagcgcccgattgt
gtcgcggctggcctggccacgcattattgcccgtccggccagtatgatgcgctcatcgag
gcgcttgagagcgccgacctgaccggcgaagacgcgctggaagtcctgctggaggaattc
tccggcgatccgggcgatagcgacctttccgtgaccggtggactgattgatgcggccttt
gccggcgacagtgtggacgacatcctcgcccggatcgaagcggcgggtgatccctggtcg
gccaagcaggcgaaaatcctcggcaccaagtcgccgacggccctgaagctgacgctggcc
tgcctgcgcaagggcgctgatctttccttcgaggatgtgatgcgccaggacttgcgggtc
tccagctggtgcctgaccggaaccgatttctacgagggtgtgcgcgccgtcatcatcgac
aaggaccaggcaccgaaatgggcgccggccgcggctgacagcgagatcgaaaaggccttc
gcgccactcgatgcggcccatgagatgagcttcctcgacgaggcctga

DBGET integrated database retrieval system