KEGG   Maricaulis maris: Mmar10_1577Help
Entry
Mmar10_1577       CDS       T00394                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mmr  Maricaulis maris
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mmar10_1577
Enzymes [BR:mmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Mmar10_1577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1725977..1726549)
Genome map
AA seq 190 aa AA seqDB search
MNTGKQSAPIYIALGANLPLGEWSPRETLARARIALAEAGLGIVSASSDWHSPAWPDPSE
PPYVNAVAEIASDQSARAILERLHAIEATFGRKRAVCNEPRPLDLDLIDCRGERTDAPDG
LVLPHPRATSRAFVLLPLAEIAPGWSDPVSGQSIIDLIAALPQADRSATYKLQESGKLSP
DHLAFEGRGD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgggaaaacaatctgcgccgatatatatcgcgctcggggccaatcttccactg
ggcgagtggagcccgcgtgagacccttgcccgggcgcggatcgccctggcagaggcgggt
ctcggtatcgtgtcggcgtcctcggactggcatagcccggcctggcccgacccgtccgag
ccgccctatgtcaacgccgttgccgagattgcctcggaccagtccgcccgggccatcctc
gaaaggctgcacgccattgaagcgactttcggacgcaagcgcgccgtgtgcaatgagccg
cggccgctcgatcttgatctcattgattgtcggggcgagcggacagacgcgccggacggg
ttggtccttccccatcccagggccacgtcacgagccttcgtgttactgccactggccgag
attgcgccgggctggagcgacccggtgagcggacagtccatcattgatctgatcgccgca
ttgccgcaggcggatcgcagcgcaacatacaagctgcaagagagcggaaaactctcaccc
gaccaccttgcttttgaagggcgaggggattag

DBGET integrated database retrieval system