KEGG   Maricaulis maris: Mmar10_1614Help
Entry
Mmar10_1614       CDS       T00394                                 

Definition
histidinol dehydrogenase, histidinol-phosphatase (EC:1.1.1.23 3.1.3.15)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mmr  Maricaulis maris
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmar10_1614
  Amino acid metabolism
   00340 Histidine metabolism
    Mmar10_1614
Enzymes [BR:mmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mmar10_1614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1766946..1768841)
Genome map
AA seq 631 aa AA seqDB search
MLDILNWTDASPEARTRALTRPASSSSAGPAARDIVDAIRDQGDEAVRAYAKRLDGYAPG
DFRVPEGVLKAARAALDPRDAEAIKAAADAVRRFHVQQGYRGYSVETWPGVTASRRATPV
DTAALYVPAGSAPLVSSLIMLAIPAQLAGVPRIVVVAPPAGDGGVNPALLAAADLLGLDE
VYAIGGAQAIAALSFGAAGLPRADKIFGPGNAYVAAAKAYVSSLPGGPAVDLPAGPSEVM
VIADETADPDLVASDLLSQAEHDPSAQVMLVCFDAATADRVTASVAKLLEDLPRAAIARE
ALAASAILVCDSVDDAIDIANIYAPEHLILQAESAERLLAGVRHAGSIFVGAWTPEAAGD
YAAGPNHTLPTAGAARAHGGVSVESFQKTTTILRASEAGAVALAPTVERLAALEQLDAHG
LAMRLRRERANTGDVAPDAGPRAGTKRRKTKETDVTVTVNLDRDGPIRIATGIGYFDHML
DQVARHGGFALDVAVEGDLEIDGHHTIEDVCLTFGEALRAALGDKRGLGRFGFELPMDES
RAAAWIDLSGRPFAKFEGEIPGEFVGEFPVEMTAHAFRSIAESLGAAIHLKVEGENAHHM
VEGCFKAFGRALRQALRVEGDALPSTKGMLA
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacattctcaactggaccgacgcgtctcccgaagcccggacgcgagccctgacc
cgtccggccagcagcagctctgccggtccggctgcgcgcgatatcgtcgatgccatccgt
gatcagggcgatgaagccgtgagggcctacgccaagcgcctcgacgggtacgccccgggt
gacttccgagtgcccgaaggtgtgctcaaggcggcccgggcggcgcttgatccacgcgat
gccgaagccatcaaggccgcggccgatgccgttcgccgttttcacgtccagcaaggctat
cgcggctacagtgtcgagacctggcccggcgtgacggcctcgcgtcgggcgacaccggtc
gacacggcggcgctctatgtcccggccggttccgcgccgctggtttcctcgctgatcatg
ctggcgattcccgcccagctggccggggttccgcggattgtggtagttgccccgccggcc
ggagatggcggcgtcaatccggcgctgctggccgctgcggacctgctgggcctggacgag
gtctatgccatcggcggtgcgcaagcgattgcggcgctctctttcggtgctgccggactg
ccgcgagccgacaagattttcggcccgggcaatgcctatgtcgccgcggcgaaagcctat
gtcagcagcctgccgggcggcccggcggtcgaccttcccgcggggccgagcgaggtcatg
gtgatcgccgatgagaccgccgaccctgacctcgtcgccagcgatctgctgagccaggcc
gagcacgacccctccgcccaagtgatgctggtctgttttgacgccgcaacggcggatcgg
gtgaccgcatccgtcgccaagttgctcgaagacctgccccgcgcggcgatcgcccgggag
gccctggctgcgtctgccatactggtttgcgacagcgtcgatgacgccatcgacatcgcc
aacatctacgccccggaacacctgatcctgcaggcggagtccgccgagcgtcttctcgcg
ggagtgcggcatgcgggctcgatttttgtcggggcctggacgcctgaagcggccggtgat
tatgccgccgggcccaaccacaccctgcccacagccggtgcggcccgggcgcatggcggc
gtgtcggtggagagcttccagaagaccacaaccatcctgcgggccagcgaggccggcgcc
gtcgcccttgcgccgacggtcgaacgcctggcggcgctggagcaactcgacgcgcacggt
ctcgccatgcgtttgcggcgcgagcgggccaatacgggcgatgtcgcgccggatgccggc
ccgcgtgccgggaccaaacgccgcaagaccaaggagaccgatgtcacggtcaccgtcaat
ctggaccgcgacggaccaatccgcattgccaccgggatcggctatttcgaccacatgttg
gaccaggtcgcccgtcatggcggatttgcgctcgacgtcgcggtcgagggagatctggag
atcgatggacaccacaccattgaagatgtctgcctgaccttcggtgaggctctgcgcgct
gccctgggtgacaagcgcggactgggccggttcggcttcgaattgccgatggatgaaagc
cgcgcggcggcctggatcgacctgtccggtcgtcctttcgcgaagttcgagggtgagatt
cccggtgagttcgtcggtgagttcccggtcgaaatgacggcccacgccttccgctcgatc
gcggaaagcctcggtgcggcgatccacctcaaggtcgagggcgagaatgcccatcacatg
gtcgagggctgtttcaaggctttcgggcgcgccctgcgtcaggccttgcgggtcgagggc
gacgcgcttccgtcaaccaagggcatgctggcgtga

DBGET integrated database retrieval system