KEGG   Maricaulis maris: Mmar10_1621Help
Entry
Mmar10_1621       CDS       T00394                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmr  Maricaulis maris
Pathway
mmr00010  Glycolysis / Gluconeogenesis
mmr00620  Pyruvate metabolism
mmr00640  Propanoate metabolism
mmr00680  Methane metabolism
mmr01100  Metabolic pathways
mmr01110  Biosynthesis of secondary metabolites
mmr01120  Microbial metabolism in diverse environments
mmr01130  Biosynthesis of antibiotics
mmr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmar10_1621
   00620 Pyruvate metabolism
    Mmar10_1621
   00640 Propanoate metabolism
    Mmar10_1621
  Energy metabolism
   00680 Methane metabolism
    Mmar10_1621
Enzymes [BR:mmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mmar10_1621
Lipid biosynthesis proteins [BR:mmr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mmar10_1621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABI65913
JGI: Mmar101621
UniProt: Q0AP74
Position
1773896..1775851
Genome map
AA seq 651 aa AA seqDB search
MSQSAQNAIYPVAAERAAAAGIDADRRADMYRRSLDTPDEFWREEAQRIDWIVPFTEVSD
VSWNKDDLHIRWFADGTLNASANCIDRHLPARADDPAIIWEGDDPTVDATITYAQLHEKV
CRLANGLKSVGVKKGDRVTIYMPMVPEAAYAMLACARIGAVHSVVFGGFSPDALAGRIID
CESRFVITADEGLRGSRPIPLKANVDKAVATAGIVDKVIMVKRTGGAVDWDASRDVAYEA
LVQAASPDCPPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYMVWASMTHEYVFDYKPGE
IYWCTADVGWVTGHTYIVYGPLANGATTLMFEGVPTWPGPDRLWQVVDKHQVNTLYTAPT
AIRALMREGDGPVKKHSRSSLRLLGTVGEPINPEAWNWYYNVVGDGRCPIVDTWWQTETG
GALITPLPGATALKPGSATLPIFGVEPALMDAEGQRIADSGPASGNLVICRSWPGQMRTI
YGDHQRFIETYFSTYPGLYFTGDGARRDEDGYWWITGRVDDVLNVSGHRLGTAEIESALV
AHKDVAEAAVVGYPHDLKGQGIYCYVTLMGGRVAADEDVDQLRKWVRQEIGPVATPDLIQ
FAPALPKTRSGKIMRRILRKIAENEFGNLGDTSTLADPGVVDDLIENRKNR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaatccgctcagaatgccatctacccggtcgccgccgaacgcgccgcggcggcg
ggcattgatgccgaccgccgtgccgacatgtatcgccgttcgctcgacacgccggatgaa
ttctggcgcgaggaagcgcagcggatcgactggatagtgcccttcacagaagtctcggat
gtcagctggaacaaggatgacctgcacatccgctggtttgccgacggcaccctcaatgcc
agcgccaactgcatcgaccggcacttgcccgcgcgagccgatgaccccgccatcatctgg
gagggtgatgatccgaccgtcgatgcgaccatcacctatgcccagttgcacgagaaagtc
tgccgcctggccaatggcctcaaatctgtcggcgtgaagaagggcgacagggtcacgatc
tacatgccgatggtcccggaagcggcctatgccatgctggcctgtgcccgcatcggtgcc
gttcactcggtcgtcttcggcggcttttcgccggacgcgctggccggccgtatcatcgat
tgcgaaagccgtttcgtcattaccgccgatgaaggcctgcgcggctccagaccaatcccg
ctgaaggccaatgtcgacaaggcggtcgcgaccgccgggattgtcgacaaggtgatcatg
gtgaaacgcacaggcggcgcggttgactgggacgccagccgcgatgtcgcctacgaagcg
ctggtccaggcggccagccccgactgtccgcccgagccgatgaatgccgaggacccgctc
tttatcctctacacctcaggatcgaccggcaagcccaagggcgtgttgcacacgaccggc
ggttacatggtctgggcctcgatgacccatgaatatgtgttcgactacaagccgggcgag
atctactggtgcaccgccgatgtcggctgggtcaccgggcacacctatatcgtctacgga
ccgctggccaatggcgccaccacgctgatgttcgagggcgtgccgacctggccgggaccg
gatcgcctctggcaggtggtcgacaagcaccaggtcaacacgctctacacggcacccacc
gcgatccgggccctgatgcgtgagggggatgggccggtgaagaagcactcccgctcatcc
ctgcgcctgctgggcacggttggcgagccgatcaatccggaagcctggaactggtattac
aatgtggtcggcgacgggcgctgcccgattgtcgatacctggtggcagaccgagacaggt
ggcgcgctgatcacccccctgcccggtgcaacggcgctgaaaccgggctcggcgacattg
ccgatcttcggggtcgagccggccctgatggatgccgaaggccagcggatcgccgatagc
ggaccggcctcgggcaatctcgtcatctgccgctcctggcccggtcagatgcggaccatt
tacggcgatcaccaacgtttcatcgagacctatttctcgacctatcccggcctttatttc
accggcgacggggcccggcgtgatgaggacggctattggtggatcaccgggcgggtcgat
gatgtgctcaacgtctccggacaccgtctcggcacggccgagatcgagagcgcactggtc
gcccacaaggatgtcgccgaagcggccgtggtcggttatccgcatgacctcaagggtcag
ggcatttattgctatgtcaccctgatgggcggacgtgtcgccgccgatgaggatgtcgac
cagctcaggaaatgggtacgccaggaaatcgggccggtggcgacaccggacctgatccag
ttcgccccggccctgcccaagacccgctcaggcaagatcatgcgccgcatcctgcgcaag
atcgccgagaacgaatttggcaatctgggagacacgtcaacgctcgccgaccccggcgtt
gttgacgacctgatcgagaaccggaagaaccgttag

DBGET integrated database retrieval system