KEGG   Maricaulis maris: Mmar10_1624Help
Entry
Mmar10_1624       CDS       T00394                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mmr  Maricaulis maris
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmar10_1624
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mmar10_1624
   00630 Glyoxylate and dicarboxylate metabolism
    Mmar10_1624
Enzymes [BR:mmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mmar10_1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1778319..1779962)
Genome map
AA seq 547 aa AA seqDB search
MTLIAPSGVEVLGHLEPGYRDILSHEALGFLAGLHRRFEKRRQSLLRYRKERQAELDQGA
LLMFPHETVDIRSGEWKVRPAPADLQDRRVEITGPVDRKMVVNALNSGAKCFMADFEDAT
SPLWSNLIEGQINLRDANTREIDFTDPKNNKRYQVKDDAAVLIVRPRGLHLDERHVHVNG
QAISGSLFDFGLYVFHNHAALKERGTAPYFYLPKLESRLEARLWSLVFQHAEDELGLERG
TLRATVLIETLPAAFELDEILYELKDHIVGLNCGRWDYIFSYIKRLKSRPEHVLPDRSAV
TMSSPFMAAYSRRVVAVCHRRGAHAMGGMSAFIPVKNDPAANAAATEKVREDKLREVKNG
HDGTWVAHPDLVPVAMEVFNERMKGPNQLDRPADPHERPVTTQQLLEAPAGDITDAGVND
NIDVAIRYIAAWLGGRGAVPIRNLMEDAATAEIARAQLWQWRTFGQSTKEGTALTGPMLE
NKIEDICSTIQDEVPDQTELCDRIRAAADILTGLVLSEDFAEFLTLPAYDRLTAELKAPM
KLMEFED
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcattgccccttccggcgtcgaagtcctgggccatctcgagcccggctatcgc
gacattctcagccatgaagcactcggcttcctggccggcctgcaccgtcgtttcgaaaag
cgacgccagtccttgctgcgctaccgcaaggagcgccaggccgagctcgaccagggcgcg
ctgttgatgttcccgcacgaaaccgtcgacatccgttcaggcgaatggaaggtccgtccg
gcccccgccgacctgcaggatcgtcgcgtcgagatcaccggcccggtcgaccgcaagatg
gtcgtcaacgcgctcaattccggcgccaaatgcttcatggcagacttcgaggacgcgaca
tcaccgctgtggtcgaacctgatcgagggccagatcaatctgcgcgacgccaatacccgc
gagatcgatttcaccgatcccaagaacaacaagcgctatcaggttaaggatgacgcggca
gtcctgatcgtccgtccgcgcggcctgcatctcgacgagcgccatgttcatgtcaacggc
caggcgatctccggctcgctgttcgatttcggcctctatgtcttccacaatcacgcggcc
ctgaaggaacgcggcacggcgccgtatttctacctgcccaagctggaaagccggctggaa
gcgcgtctgtggagcctggtcttccagcatgccgaggacgagctcggcctggagcgcggc
acgctgcgcgccacggttctcatcgagaccctgccggcagccttcgagctggacgagatc
ctgtacgagctgaaagaccatatcgtcggcctcaattgcggccgctgggattatatcttc
agctatatcaagcgcctcaagtcgcgcccggaacatgtccttccggatcgttcggccgtg
accatgagttcacccttcatggcggcttattcgcgccgtgtggtggccgtctgtcaccgc
cggggtgcccacgccatgggcggcatgtcggccttcatcccggtcaagaatgacccggct
gccaatgcggcagcgaccgagaaggtccgcgaggacaagctgcgtgaagtgaagaatggc
catgacggtacctgggtcgctcaccccgatctggttcctgttgccatggaagtcttcaac
gaacgcatgaagggccccaaccagctcgaccgtccggccgacccgcacgagcgtccggtg
accacgcagcaattgctcgaggctccggccggcgacatcaccgatgctggcgtcaacgac
aatatcgacgtcgccatccgctatatcgccgcctggctgggtggacgcggagcggtgccg
atccgcaatctgatggaggatgccgcgacagccgagatcgcccgtgcccagctgtggcaa
tggcgcaccttcggtcagtccaccaaggaaggcaccgcgctcaccggcccgatgctggaa
aacaagatcgaggacatctgctcgaccatccaggatgaagtgccggatcagaccgagctg
tgcgatcgcatccgcgccgctgctgatatcctgaccgggctggtcctgtccgaggacttc
gccgaattcctgaccttgccggcctatgaccgcctcacggccgaactcaaggcgccgatg
aagctgatggaattcgaggactga

DBGET integrated database retrieval system