KEGG   Maricaulis maris: Mmar10_1625Help
Entry
Mmar10_1625       CDS       T00394                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mmr  Maricaulis maris
Pathway
mmr00630  Glyoxylate and dicarboxylate metabolism
mmr01100  Metabolic pathways
mmr01110  Biosynthesis of secondary metabolites
mmr01120  Microbial metabolism in diverse environments
mmr01200  Carbon metabolism
Module
mmr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mmar10_1625
Enzymes [BR:mmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mmar10_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABI65917
JGI: Mmar101625
UniProt: Q0AP70
Position
complement(1780045..1781331)
Genome map
AA seq 428 aa AA seqDB search
MTTFAELVPNTADDRFNGIERPYSPEDVQKLRGSITISQTLAERGANKLWELLKTEPYIN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTAGTMYPDQSLYPANSAPELAKKINRA
LQRADQIEVSETGEASRDWFAPIVADAEAGFGGTLNCFEIMKAFIEAGAAGVHFEDQVAA
EKKCGHLGGKVLIPTSQHERNLAAARLAADVMGVSTITVARTDAESANLINSDIDERDHE
FIDFDAGRTPEGFFRLKEGVGVDHCIKRGLAYAKIADLLWWETSKPNLDEARRFAEAIQK
EFPGKMMAYNCSPSFNWEANLDKATIETYQQELGAMGYKFQFVTLAGFHQLNHGMFELAR
GYKSRGMGAYSELQQAEFASETDGYTATRHQREVGTGYFDKVSLAISGGKASTTAMGEST
ESAQFAAE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttttgcggaactggtccccaacacggccgatgatcgtttcaacggtatcgag
cgtccctactcccccgaagacgtgcagaagctgcgcggctcgatcaccatcagccagacc
ctggccgagcgcggtgccaacaagctgtgggagctcctgaagaccgaaccctatatcaac
gcgctgggcgcgctgtcaggcaatcaggccatgcagatggtccgcgccgggctgaaggcc
atctacctgtccggttggcaggtcgccgccgacgccaacacggccggcaccatgtatccc
gaccagtcgctctacccggccaattcggccccggaactggccaagaagatcaaccgcgcc
ctgcagcgcgccgaccagatcgaagtgtccgagaccggcgaggccagccgtgactggttt
gccccgatcgtcgccgatgccgaggccggttttggcggcacgctgaactgctttgaaatc
atgaaggccttcatcgaagccggtgctgccggcgtccatttcgaagaccaggtcgcagcc
gaaaagaaatgtggccatctgggcggcaaggtgttgatcccgaccagccagcacgagcgc
aatctcgctgcggcccgtctcgccgccgatgtcatgggtgtctcgacgatcaccgttgcc
cggaccgatgccgaatccgccaacctgatcaattccgacatcgacgagcgcgaccatgaa
ttcatcgatttcgacgctggccgcacgccggaaggcttcttccgcctgaaggaaggcgtt
ggcgttgatcactgcatcaagcgtggcctggcctatgccaagatcgccgacctgttgtgg
tgggaaacctccaagccgaatctcgacgaagcccgccgcttcgctgaggcgatccagaag
gaattcccgggcaagatgatggcgtacaactgctcgccgtccttcaattgggaagccaat
ctggacaaggccacgattgaaacctaccagcaggaactcggcgccatgggctacaagttc
cagttcgtgaccctggccggcttccaccagctcaaccacggcatgttcgaactggctcgc
ggctacaagtcgcgtggcatgggtgcctattccgagctgcaacaggccgagttcgcgtcc
gaaaccgatggctacaccgcaacgcgtcaccagcgcgaagtcggcaccggctatttcgac
aaggtctcgctggccatttccggcggcaaggcctcgaccacggccatgggcgaatccacc
gagtcagcccagttcgcagccgagtaa

DBGET integrated database retrieval system