KEGG   Maricaulis maris: Mmar10_1625Help
Entry
Mmar10_1625       CDS       T00394                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mmr  Maricaulis maris
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmar10_1625
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mmar10_1625
Enzymes [BR:mmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mmar10_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1780045..1781331)
Genome map
AA seq 428 aa AA seqDB search
MTTFAELVPNTADDRFNGIERPYSPEDVQKLRGSITISQTLAERGANKLWELLKTEPYIN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTAGTMYPDQSLYPANSAPELAKKINRA
LQRADQIEVSETGEASRDWFAPIVADAEAGFGGTLNCFEIMKAFIEAGAAGVHFEDQVAA
EKKCGHLGGKVLIPTSQHERNLAAARLAADVMGVSTITVARTDAESANLINSDIDERDHE
FIDFDAGRTPEGFFRLKEGVGVDHCIKRGLAYAKIADLLWWETSKPNLDEARRFAEAIQK
EFPGKMMAYNCSPSFNWEANLDKATIETYQQELGAMGYKFQFVTLAGFHQLNHGMFELAR
GYKSRGMGAYSELQQAEFASETDGYTATRHQREVGTGYFDKVSLAISGGKASTTAMGEST
ESAQFAAE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttttgcggaactggtccccaacacggccgatgatcgtttcaacggtatcgag
cgtccctactcccccgaagacgtgcagaagctgcgcggctcgatcaccatcagccagacc
ctggccgagcgcggtgccaacaagctgtgggagctcctgaagaccgaaccctatatcaac
gcgctgggcgcgctgtcaggcaatcaggccatgcagatggtccgcgccgggctgaaggcc
atctacctgtccggttggcaggtcgccgccgacgccaacacggccggcaccatgtatccc
gaccagtcgctctacccggccaattcggccccggaactggccaagaagatcaaccgcgcc
ctgcagcgcgccgaccagatcgaagtgtccgagaccggcgaggccagccgtgactggttt
gccccgatcgtcgccgatgccgaggccggttttggcggcacgctgaactgctttgaaatc
atgaaggccttcatcgaagccggtgctgccggcgtccatttcgaagaccaggtcgcagcc
gaaaagaaatgtggccatctgggcggcaaggtgttgatcccgaccagccagcacgagcgc
aatctcgctgcggcccgtctcgccgccgatgtcatgggtgtctcgacgatcaccgttgcc
cggaccgatgccgaatccgccaacctgatcaattccgacatcgacgagcgcgaccatgaa
ttcatcgatttcgacgctggccgcacgccggaaggcttcttccgcctgaaggaaggcgtt
ggcgttgatcactgcatcaagcgtggcctggcctatgccaagatcgccgacctgttgtgg
tgggaaacctccaagccgaatctcgacgaagcccgccgcttcgctgaggcgatccagaag
gaattcccgggcaagatgatggcgtacaactgctcgccgtccttcaattgggaagccaat
ctggacaaggccacgattgaaacctaccagcaggaactcggcgccatgggctacaagttc
cagttcgtgaccctggccggcttccaccagctcaaccacggcatgttcgaactggctcgc
ggctacaagtcgcgtggcatgggtgcctattccgagctgcaacaggccgagttcgcgtcc
gaaaccgatggctacaccgcaacgcgtcaccagcgcgaagtcggcaccggctatttcgac
aaggtctcgctggccatttccggcggcaaggcctcgaccacggccatgggcgaatccacc
gagtcagcccagttcgcagccgagtaa

DBGET integrated database retrieval system