KEGG   Maricaulis maris: Mmar10_1713Help
Entry
Mmar10_1713       CDS       T00394                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mmr  Maricaulis maris
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mmr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mmr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1879864..1880826
Genome map
AA seq 320 aa AA seqDB search
MSRAEFSYDFPHRHLLSVADLNPVDIQIIFERAAHHLATNRTPDKRSDVLRGLTVLNLFF
EASTRTQGSFEMAGKRLGADVVNFAVAHSSASKGESLSDTARTLAAMKPDIMVVRHSATG
APQFLADHTGLAVVNAGDGMHEHPTQALLDSFTLSQHWGSVGGRRILIVGDILHSRVARS
NIGLLNILGAEIRLCAPPTLLPSDVDQWGCDVFHDLDEALKGCDAVMALRQQRERMSGGF
VPSEREFFHLFGLTHERLEVASPDVLVMHPGPMNRGVEIHTKLADDPERSVILEQVESGV
AVRMAILELIGANIRKEASA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgcggaattttcctacgacttcccccaccgccaccttttatcggtggccgac
ctcaaccccgttgatatccagatcattttcgagcgcgccgcgcatcatctggcgaccaac
cggacgccggacaagcgctctgacgtgctgcgcggcctgaccgtgctcaacctcttcttc
gaggcctcgacgcgaacgcaaggctcgttcgagatggcgggcaagcggctcggcgctgat
gtggtcaactttgccgtggcccattcttccgcctccaaaggcgagagtctgtcggacacg
gcgcggactctcgcggccatgaagcccgacatcatggtcgtacgccactcggcaaccggc
gcgccgcaattcctcgccgatcacaccggcctggctgtggtcaatgccggcgacggcatg
catgaacacccgacccaggccctgctcgacagcttcaccctgtcgcaacactggggctcg
gtcggtggccgccgcatcctgattgtcggcgacatcctgcattcgcgggtggcccgctcg
aatatcggcctgttgaacattctcggcgccgagatccgcctgtgtgcgccgcccaccctg
cttccctccgatgtcgaccagtggggctgcgacgtcttccacgatctcgacgaggcgttg
aagggctgcgacgccgtcatggccctgcgccagcagcgcgagcgcatgtccggcggcttc
gtgccgtccgaacgggaattcttccacctgttcggcctcacccatgagcgccttgaagtg
gcgtcgccggacgttctggtcatgcatcccgggccgatgaatcgcggcgtcgaaatccat
accaagctggccgatgatcccgagcgcagcgtgatcctggaacaggtggagagcggcgtt
gcggtgcgcatggcgatccttgaactgatcggcgccaatatccgcaaggaggcctcggca
tga

DBGET integrated database retrieval system