KEGG   Maricaulis maris: Mmar10_1713Help
Entry
Mmar10_1713       CDS       T00394                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mmr  Maricaulis maris
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mmar10_1713
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mmar10_1713
Enzymes [BR:mmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mmar10_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1879864..1880826
Genome map
AA seq 320 aa AA seqDB search
MSRAEFSYDFPHRHLLSVADLNPVDIQIIFERAAHHLATNRTPDKRSDVLRGLTVLNLFF
EASTRTQGSFEMAGKRLGADVVNFAVAHSSASKGESLSDTARTLAAMKPDIMVVRHSATG
APQFLADHTGLAVVNAGDGMHEHPTQALLDSFTLSQHWGSVGGRRILIVGDILHSRVARS
NIGLLNILGAEIRLCAPPTLLPSDVDQWGCDVFHDLDEALKGCDAVMALRQQRERMSGGF
VPSEREFFHLFGLTHERLEVASPDVLVMHPGPMNRGVEIHTKLADDPERSVILEQVESGV
AVRMAILELIGANIRKEASA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgcggaattttcctacgacttcccccaccgccaccttttatcggtggccgac
ctcaaccccgttgatatccagatcattttcgagcgcgccgcgcatcatctggcgaccaac
cggacgccggacaagcgctctgacgtgctgcgcggcctgaccgtgctcaacctcttcttc
gaggcctcgacgcgaacgcaaggctcgttcgagatggcgggcaagcggctcggcgctgat
gtggtcaactttgccgtggcccattcttccgcctccaaaggcgagagtctgtcggacacg
gcgcggactctcgcggccatgaagcccgacatcatggtcgtacgccactcggcaaccggc
gcgccgcaattcctcgccgatcacaccggcctggctgtggtcaatgccggcgacggcatg
catgaacacccgacccaggccctgctcgacagcttcaccctgtcgcaacactggggctcg
gtcggtggccgccgcatcctgattgtcggcgacatcctgcattcgcgggtggcccgctcg
aatatcggcctgttgaacattctcggcgccgagatccgcctgtgtgcgccgcccaccctg
cttccctccgatgtcgaccagtggggctgcgacgtcttccacgatctcgacgaggcgttg
aagggctgcgacgccgtcatggccctgcgccagcagcgcgagcgcatgtccggcggcttc
gtgccgtccgaacgggaattcttccacctgttcggcctcacccatgagcgccttgaagtg
gcgtcgccggacgttctggtcatgcatcccgggccgatgaatcgcggcgtcgaaatccat
accaagctggccgatgatcccgagcgcagcgtgatcctggaacaggtggagagcggcgtt
gcggtgcgcatggcgatccttgaactgatcggcgccaatatccgcaaggaggcctcggca
tga

DBGET integrated database retrieval system