KEGG   Maricaulis maris: Mmar10_1835Help
Entry
Mmar10_1835       CDS       T00394                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
mmr  Maricaulis maris
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mmr00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mmr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2003017..2003517
Genome map
AA seq 166 aa AA seqDB search
MTPARLALLPLFALVACGNDPAPATAANSSDTAATLVAADDAVMGAIVQTVILDSLGEAY
ASADLANGARQFRRCQSCHTLDAGGRHTVGPNLHRIIGRPAAIADRFSFSSQLEDAGLTW
DLETLDAWIANPRALVPGNRMSFVGLRNPEDRRDLIAYIAVESAVE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacaccagcccgccttgccctccttccgcttttcgcgctcgttgcgtgcggaaacgac
ccggccccggccactgcagcgaactcgtctgacacggctgcgacattggtggccgccgac
gacgccgtaatgggcgcgattgtccagaccgtcattctggacagtttgggtgaagcatac
gcctctgccgatctcgcaaacggcgcgcggcagttccggcgctgtcagtcctgccacacg
ctcgatgcaggcggtcgccacactgttgggcccaacctgcataggattatcggccgcccg
gccgcaattgcagaccggttcagcttttccagccagttggaggacgccggactaacctgg
gacctggaaacgctggacgcctggatcgccaacccgcgggcgcttgtgcccggcaatcgc
atgagttttgtcggtcttcgtaaccccgaggatcgccgcgacttgatagcctacattgcg
gtcgaatccgccgtagaataa

DBGET integrated database retrieval system