KEGG   Maricaulis maris: Mmar10_1878Help
Entry
Mmar10_1878       CDS       T00394                                 

Definition
phosphodiesterase I (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mmr  Maricaulis maris
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mmar10_1878
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Mmar10_1878
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mmar10_1878
Enzymes [BR:mmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Mmar10_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2052267..2053553
Genome map
AA seq 428 aa AA seqDB search
MTFRILAIAMLTSLVAACSHLRAPSAEPVAAEAPPVVIMVGLDGLRFDAIDRHEAPNLRA
LAARGTRPERMVSAMPTKTFVNFYTLATGLYPEHHGMVSNSPYDRRLDETFSNSGGSPQD
PRWWGGEPIWITAEQQGLRSHIMFWLGSEVEIDGTRPTIWHPYEHEKPYEERIDEVLTWF
DAPVAEQPRFAAVYMDHVDTVLHTNGVGTPQEAEAVARVDALVGQLIAGLEARGVMERTT
LLIVSDHGMVDVSTERTIMIDTLADLDGLHIDEFASRYSPGPESFIMGYGDEATVERIHA
ELQDAHPHMTAYRRQDMPEHWHFDHPDRGPDLFVLADPGWLIITSETDPENPYFTSLRAT
HGFDNLDETMGATFIGAGPIFPQGSRPAAFENVNVYGLIACALDLEPAPTDGSAEEVERI
TGGRCPAE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttcgtattctcgccatcgccatgctgaccagcctggtggccgcatgcagccat
ctgcgtgcaccgtccgccgaaccggttgcggccgaagcgccacccgtggtgatcatggtc
gggctggacgggttgcgctttgacgccatcgaccgccacgaagcgcccaatctgcgcgcc
ctcgccgcgcgcgggacgcgtccggagcgcatggtttcggcgatgccgaccaagaccttc
gtcaatttctacaccctggcgaccggcctctatcccgagcatcacggcatggtctccaac
tcgccctatgaccggcggctggacgagaccttttccaattccggcggcagtccgcaggac
ccgcgctggtggggcggcgagccgatctggatcacggcagagcagcagggcctgcgctcg
cacatcatgttctggctcggctcggaagtggagatcgacggcacccgtccgacgatctgg
cacccctatgagcacgaaaaaccctatgaagaacgcattgatgaagttctcacctggttc
gacgcaccggtcgccgagcagcctcgcttcgccgccgtctacatggatcatgtcgacacg
gtgctgcacaccaatggcgtcggcacgccgcaggaagccgaggccgtcgcgcgggtcgat
gccctggtcggccagctgatcgccgggctggaagcgcgcggcgtgatggagcggacaacc
ctcttgatcgtttcagatcatggtatggtcgatgtctcgaccgagcggaccatcatgatc
gacacgctcgccgatctggacgggctgcatattgacgagttcgccagccgttacagcccc
ggtccggaatccttcatcatgggctatggcgatgaggccacggtcgagcgcatccatgcc
gagctgcaggatgcccatccgcacatgaccgcctatcgccgccaggacatgccggagcac
tggcatttcgatcaccccgatcgcggcccggatctcttcgtcctggccgatcccggctgg
ctgatcatcaccagcgagaccgatcccgaaaacccctatttcaccagcctgcgggccacc
cacggctttgacaatctcgacgaaaccatgggcgcgaccttcatcggcgccggcccgatc
ttcccgcaaggcagccgcccggccgccttcgagaacgtcaatgtctatggcctgatcgcc
tgcgcactggacctcgagcctgcaccgaccgatggtagcgcggaggaagttgaacggatc
acgggcggacgctgcccggcggagtaa

DBGET integrated database retrieval system