KEGG   Maricaulis maris: Mmar10_1912Help
Entry
Mmar10_1912       CDS       T00394                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mmr  Maricaulis maris
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mmar10_1912
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Mmar10_1912
Enzymes [BR:mmr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mmar10_1912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2092493..2093509)
Genome map
AA seq 338 aa AA seqDB search
MTIASVIYGLAGTKLSPDEKAFFRDIDPWGFILFARNIEGINQVSRLTLELRDCVGRDAP
ILIDQEGGRVARLRPPTWRAAPAAQRFADLWQVDEELAIEATRINHRLLAHELRTIGVDV
DCAPVADLRIEGADDIIGDRAFGTTPEPVIHLGRAAMDGLMAGGVAPIIKHIPGHGRARA
DSHLELPVVPEEHGLLSETDFAPFKGLNDAPMAMTAHIVYSDIDRDLPATQSADMVDKVV
RGEIGFDGLLMTDDLSMKALTGTFRERGELSLKAGCDMLLHCNGQMSEMIGVAEGTTALT
GRALERAEAAERIRDVIEDFDPDDAESRLNDCLDRLPA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgcatccgtgatctacggtctggccggcaccaagctgagcccggacgagaaa
gcctttttccgcgacattgatccgtggggcttcatcctgttcgcccgcaatatcgagggc
atcaaccaggtctcccgtctgacactggagctgcgcgactgtgtcggtcgcgacgcgccc
atcctgatcgaccaggaaggcgggcgtgtcgcccggctgcggcctccgacctggcgtgcc
gcgcctgcggcccagcgctttgccgacctctggcaagtcgatgaggagctggcgatcgag
gcgacccgcatcaatcaccgcctgctggctcacgagctgcgcaccatcggtgtcgatgtc
gactgtgccccggtcgccgatctgcggatcgaaggggcagacgacattattggtgaccgc
gctttcggcaccacgcccgaaccggtcatccatctgggccgcgccgccatggatggattg
atggcaggcggtgtcgcgccgatcatcaagcatatccccggacatggccgggcccgggcc
gacagccatctcgaactgcccgtcgtgccggaagagcatggcctgttgtctgagacggat
tttgcacccttcaagggtctaaatgatgcgccgatggcgatgacggcccatattgtctat
tccgacatcgaccgcgacctccctgccacccagtccgcagacatggtcgacaaggtggtg
cgtggcgagatcgggtttgatgggctgcttatgacagacgatctgtcgatgaaggctctg
accggcacattccgcgagcgcggcgagctgtccctgaaggccggctgcgacatgcttttg
cactgtaatggccagatgtccgagatgatcggggtcgccgaaggaacgacagccctgacc
ggccgggcgctggaacgggccgaagcggccgagcggattcgcgacgtgatcgaggatttt
gacccggacgatgccgaatcgcggctcaatgactgtctggacaggcttcccgcctga

DBGET integrated database retrieval system