KEGG   Maricaulis maris: Mmar10_2025Help
Entry
Mmar10_2025       CDS       T00394                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mmr  Maricaulis maris
Pathway
mmr00670  One carbon pool by folate
mmr00790  Folate biosynthesis
mmr01100  Metabolic pathways
Module
mmr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mmar10_2025
   00670 One carbon pool by folate
    Mmar10_2025
Enzymes [BR:mmr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mmar10_2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 DUF2064
Motif
Other DBs
NCBI-ProteinID: ABI66317
JGI: Mmar102025
UniProt: Q0AN20
Position
complement(2207968..2208489)
Genome map
AA seq 173 aa AA seqDB search
MTTTIPKLVLVVARGMNGVIGVDGDLPWRLSSDLRNFKAITSGKPIIMGRKTWESLPRRP
LPGRLNIVVTRQDGYVAEGGHVAGDLGEAMDAAFMRADADGVDEVCVIGGAQIYAATLER
ADRLYLTEVEAAPEGETCLPEIDEALWRETRRELYPAGPGDDHAFMLRVLDRI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccattcccaaactcgtcctcgtcgtcgcgcgcggcatgaatggcgtcatc
ggcgtggatggcgacctgccctggcgattgtcgtcggacctcaggaatttcaaggcgatc
acctccggcaaaccgatcatcatggggcgcaagacctgggagagcctgccgcggcggccg
ctgccgggacgtctgaatatcgtggtcacgcgtcaggacggctatgtcgccgaaggcggg
catgtcgccggcgatctcggcgaggcgatggacgcggccttcatgcgggctgacgcggac
ggtgtcgacgaagtctgtgtcatcggcggtgcgcaaatctatgccgcgacgctggagcgc
gccgaccggctctatctgaccgaggtcgaggccgcgcccgagggcgagacctgcctgccg
gagatcgacgaagcgctgtggcgcgaaacccgtcgcgagctctatccggccggaccgggc
gatgatcacgccttcatgctgcgcgtgctggaccgtatctga

DBGET integrated database retrieval system