KEGG   Maricaulis maris: Mmar10_2025Help
Entry
Mmar10_2025       CDS       T00394                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mmr  Maricaulis maris
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mmr00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2207968..2208489)
Genome map
AA seq 173 aa AA seqDB search
MTTTIPKLVLVVARGMNGVIGVDGDLPWRLSSDLRNFKAITSGKPIIMGRKTWESLPRRP
LPGRLNIVVTRQDGYVAEGGHVAGDLGEAMDAAFMRADADGVDEVCVIGGAQIYAATLER
ADRLYLTEVEAAPEGETCLPEIDEALWRETRRELYPAGPGDDHAFMLRVLDRI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccattcccaaactcgtcctcgtcgtcgcgcgcggcatgaatggcgtcatc
ggcgtggatggcgacctgccctggcgattgtcgtcggacctcaggaatttcaaggcgatc
acctccggcaaaccgatcatcatggggcgcaagacctgggagagcctgccgcggcggccg
ctgccgggacgtctgaatatcgtggtcacgcgtcaggacggctatgtcgccgaaggcggg
catgtcgccggcgatctcggcgaggcgatggacgcggccttcatgcgggctgacgcggac
ggtgtcgacgaagtctgtgtcatcggcggtgcgcaaatctatgccgcgacgctggagcgc
gccgaccggctctatctgaccgaggtcgaggccgcgcccgagggcgagacctgcctgccg
gagatcgacgaagcgctgtggcgcgaaacccgtcgcgagctctatccggccggaccgggc
gatgatcacgccttcatgctgcgcgtgctggaccgtatctga

DBGET integrated database retrieval system