KEGG   Maricaulis maris: Mmar10_2457Help
Entry
Mmar10_2457       CDS       T00394                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mmr  Maricaulis maris
Pathway
mmr00521  Streptomycin biosynthesis
mmr00523  Polyketide sugar unit biosynthesis
mmr01130  Biosynthesis of antibiotics
Module
mmr_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Mmar10_2457
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mmar10_2457
Enzymes [BR:mmr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Mmar10_2457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABI66749
JGI: Mmar102457
UniProt: Q0ALU4
Position
complement(2673141..2673707)
Genome map
AA seq 188 aa AA seqDB search
MELQRLDIPDVIVVTPRRFEDDRGYFSETYNETVFAEAGIGARFVQDNHSCSLQAGTVRG
LHYQSLPHAQGKLVRVTSGAIIDVVVDVRRGSPHFGQHVKAEISAEKGSQIWVPAGFLHG
FITLQPNTHVTYKVTDFYDAGCDGSVLWSDPALGIDWGIGQSDAILSDKDAEAQSWQEFS
SPFLYPPA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggaacttcagcgcctcgatattccggacgtcattgtcgtcacgccccgtcgctttgaa
gatgatcggggttatttttccgagacctataatgaaacggttttcgccgaggcagggatt
ggcgcccgttttgtccaggacaatcattcctgctcactccaggccggtacggttcgagga
ctgcactaccagtcgctgccgcatgcacaaggcaagctggttcgtgtgacaagcggagcg
attatcgatgttgttgtcgatgtgcgccgcggaagcccccatttcgggcagcacgtgaaa
gcggaaatatcggccgagaagggcagccagatctgggtgccggccgggttcctacacggt
ttcataaccttgcagcccaacacccatgtcacttacaaggtcactgacttttacgatgcc
ggctgcgacggctcggtcttgtggtcggatccggcactgggtattgattggggaattggc
cagtcggacgcgattttgtcagataaagatgccgaggcccagtcttggcaggaattcagt
tcgccatttttatacccgcctgcttga

DBGET integrated database retrieval system