KEGG   Maricaulis maris: Mmar10_2488Help
Entry
Mmar10_2488       CDS       T00394                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/subunit
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mmr  Maricaulis maris
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmar10_2488
   00030 Pentose phosphate pathway
    Mmar10_2488
   00051 Fructose and mannose metabolism
    Mmar10_2488
   00052 Galactose metabolism
    Mmar10_2488
   00500 Starch and sucrose metabolism
    Mmar10_2488
   00520 Amino sugar and nucleotide sugar metabolism
    Mmar10_2488
  Nucleotide metabolism
   00230 Purine metabolism
    Mmar10_2488
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mmar10_2488
Enzymes [BR:mmr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mmar10_2488
    5.4.2.8  phosphomannomutase
     Mmar10_2488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2702491..2704011)
Genome map
AA seq 506 aa AA seqDB search
MTTKPHASLKPNSWEFETEALIKPTGFREYDARWWFGHPGSDKAPDLNLYGVQALGAGLG
TLIHELGVAPKIVVGHDFRSYSLSVKQALEVGLMSAGIEVHDIGLALSPTAYYAQFDLDI
PCVAMVTASHNSNGWTGVKMGANRPLTFGPDEMSRLKEIVLSGSAKTRSGGGYVRQAGVA
ERYLDDVAKDVAIKRPLKVVAACGNGTAGAFAPQALRAMGVEVVEMDCELDHTFPRYNPN
PEDMKMLHAMRDAVLEHGADVGLGFDGDGDRCGVIDNEGEEIFADKIGLMLARDLAPLHP
GASFVVDVKSTGLFAIDPVLAEHGCKTDYYKTGHSYIKRRSKELGALAGFEKSGHFFLQP
PIGRGYDDGLVAARAVLQMLERNPDKTMADLRRDLPMSYGSPTMSPACADEEKYGVVEKI
VERFQARKTNGEAVAGRAITDVNTVNGVRFSLEGGAWGLVRASSNTPNLVVVVESPNSHE
EVVSVFQAIETVLAGCPEVGEFDQKL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaagccccatgccagcctgaagcccaattcctgggagttcgagaccgaggcc
ctgatcaagccgaccggctttagggaatatgatgcgcgctggtggttcggccatcccggt
tccgataaggctcccgatctcaacctgtacggcgtgcaggcgcttggggccggtctgggc
acgctgatccatgaactcggcgtggcgccgaagatcgtcgtcggccatgacttccgaagc
tattcgctgagcgtgaaacaggcgctggaggtcggattgatgtcggcgggcatcgaagtg
catgatatcggcctggcgctctcgcccaccgcctactacgcacagtttgatctcgacatt
ccctgcgtggcgatggtcacggcgagccacaactcgaatggctggaccggcgtcaagatg
ggggccaaccgtcccttgaccttcggtccggacgagatgagccggctcaaggaaatcgtc
ctgtccggatcggcgaagacccgctccggtggtggctatgtccgtcaggctggcgttgcc
gaacgttatctcgatgatgtcgccaaagacgttgcgatcaagcgtccgctgaaggtcgtc
gctgcctgcggcaatggcacggcgggggcctttgccccgcaggcgctcagggcgatgggc
gtcgaggtcgtcgagatggattgtgaacttgaccacaccttcccgcgctacaatcccaat
cctgaagacatgaagatgctgcacgccatgcgcgatgccgtgctcgagcacggcgccgac
gtcggccttggctttgatggcgatggtgaccggtgcggtgtgatcgacaatgagggcgag
gaaatcttcgccgacaagatcgggctgatgctcgcccgcgatctggcgccactccatccc
ggtgccagttttgtcgtcgacgtgaagtccaccggcctgtttgcaatcgacccagtcctg
gccgagcacggctgcaaaaccgactattacaagaccgggcattcttacatcaagcggcgc
tcgaaggagctgggcgcgctggccggcttcgagaagtcgggccatttcttcctgcagccg
ccgatcggccgtggctatgatgacggtctggttgccgcacgggccgtgttgcaaatgctg
gagcgtaatcctgacaagaccatggccgaccttcgccgcgacctgccgatgagctacggg
tcgccgaccatgtcaccggcctgcgcggacgaagaaaaatatggcgtggttgagaagatt
gtcgaacgcttccaggcacgcaagaccaatggcgaggctgtcgccgggcgtgcgatcact
gatgtgaacacggtcaacggcgtccgtttctccctggagggcggcgcttggggtctggta
cgggccagttcgaacacgcccaaccttgtggttgtggttgagagcccaaatagccatgag
gaagtggtgtccgtgttccaggcaatcgaaacggtgttggccggttgcccggaagtgggt
gagttcgatcaaaaactttga

DBGET integrated database retrieval system