KEGG   Maricaulis maris: Mmar10_2488Help
Entry
Mmar10_2488       CDS       T00394                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mmr  Maricaulis maris
Pathway
mmr00010  Glycolysis / Gluconeogenesis
mmr00030  Pentose phosphate pathway
mmr00051  Fructose and mannose metabolism
mmr00052  Galactose metabolism
mmr00230  Purine metabolism
mmr00500  Starch and sucrose metabolism
mmr00520  Amino sugar and nucleotide sugar metabolism
mmr00521  Streptomycin biosynthesis
mmr01100  Metabolic pathways
mmr01110  Biosynthesis of secondary metabolites
mmr01120  Microbial metabolism in diverse environments
mmr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmar10_2488
   00030 Pentose phosphate pathway
    Mmar10_2488
   00051 Fructose and mannose metabolism
    Mmar10_2488
   00052 Galactose metabolism
    Mmar10_2488
   00500 Starch and sucrose metabolism
    Mmar10_2488
   00520 Amino sugar and nucleotide sugar metabolism
    Mmar10_2488
  Nucleotide metabolism
   00230 Purine metabolism
    Mmar10_2488
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mmar10_2488
Enzymes [BR:mmr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mmar10_2488
    5.4.2.8  phosphomannomutase
     Mmar10_2488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABI66774
JGI: Mmar102488
UniProt: Q0ALR9
Position
complement(2702491..2704011)
Genome map
AA seq 506 aa AA seqDB search
MTTKPHASLKPNSWEFETEALIKPTGFREYDARWWFGHPGSDKAPDLNLYGVQALGAGLG
TLIHELGVAPKIVVGHDFRSYSLSVKQALEVGLMSAGIEVHDIGLALSPTAYYAQFDLDI
PCVAMVTASHNSNGWTGVKMGANRPLTFGPDEMSRLKEIVLSGSAKTRSGGGYVRQAGVA
ERYLDDVAKDVAIKRPLKVVAACGNGTAGAFAPQALRAMGVEVVEMDCELDHTFPRYNPN
PEDMKMLHAMRDAVLEHGADVGLGFDGDGDRCGVIDNEGEEIFADKIGLMLARDLAPLHP
GASFVVDVKSTGLFAIDPVLAEHGCKTDYYKTGHSYIKRRSKELGALAGFEKSGHFFLQP
PIGRGYDDGLVAARAVLQMLERNPDKTMADLRRDLPMSYGSPTMSPACADEEKYGVVEKI
VERFQARKTNGEAVAGRAITDVNTVNGVRFSLEGGAWGLVRASSNTPNLVVVVESPNSHE
EVVSVFQAIETVLAGCPEVGEFDQKL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaagccccatgccagcctgaagcccaattcctgggagttcgagaccgaggcc
ctgatcaagccgaccggctttagggaatatgatgcgcgctggtggttcggccatcccggt
tccgataaggctcccgatctcaacctgtacggcgtgcaggcgcttggggccggtctgggc
acgctgatccatgaactcggcgtggcgccgaagatcgtcgtcggccatgacttccgaagc
tattcgctgagcgtgaaacaggcgctggaggtcggattgatgtcggcgggcatcgaagtg
catgatatcggcctggcgctctcgcccaccgcctactacgcacagtttgatctcgacatt
ccctgcgtggcgatggtcacggcgagccacaactcgaatggctggaccggcgtcaagatg
ggggccaaccgtcccttgaccttcggtccggacgagatgagccggctcaaggaaatcgtc
ctgtccggatcggcgaagacccgctccggtggtggctatgtccgtcaggctggcgttgcc
gaacgttatctcgatgatgtcgccaaagacgttgcgatcaagcgtccgctgaaggtcgtc
gctgcctgcggcaatggcacggcgggggcctttgccccgcaggcgctcagggcgatgggc
gtcgaggtcgtcgagatggattgtgaacttgaccacaccttcccgcgctacaatcccaat
cctgaagacatgaagatgctgcacgccatgcgcgatgccgtgctcgagcacggcgccgac
gtcggccttggctttgatggcgatggtgaccggtgcggtgtgatcgacaatgagggcgag
gaaatcttcgccgacaagatcgggctgatgctcgcccgcgatctggcgccactccatccc
ggtgccagttttgtcgtcgacgtgaagtccaccggcctgtttgcaatcgacccagtcctg
gccgagcacggctgcaaaaccgactattacaagaccgggcattcttacatcaagcggcgc
tcgaaggagctgggcgcgctggccggcttcgagaagtcgggccatttcttcctgcagccg
ccgatcggccgtggctatgatgacggtctggttgccgcacgggccgtgttgcaaatgctg
gagcgtaatcctgacaagaccatggccgaccttcgccgcgacctgccgatgagctacggg
tcgccgaccatgtcaccggcctgcgcggacgaagaaaaatatggcgtggttgagaagatt
gtcgaacgcttccaggcacgcaagaccaatggcgaggctgtcgccgggcgtgcgatcact
gatgtgaacacggtcaacggcgtccgtttctccctggagggcggcgcttggggtctggta
cgggccagttcgaacacgcccaaccttgtggttgtggttgagagcccaaatagccatgag
gaagtggtgtccgtgttccaggcaatcgaaacggtgttggccggttgcccggaagtgggt
gagttcgatcaaaaactttga

DBGET integrated database retrieval system