KEGG   Maricaulis maris: Mmar10_2491Help
Entry
Mmar10_2491       CDS       T00394                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmr  Maricaulis maris
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mmar10_2491
   00052 Galactose metabolism
    Mmar10_2491
   00500 Starch and sucrose metabolism
    Mmar10_2491
   00520 Amino sugar and nucleotide sugar metabolism
    Mmar10_2491
Enzymes [BR:mmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mmar10_2491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2706983..2707855
Genome map
AA seq 290 aa AA seqDB search
MTRVRKAVLPVAGFGTRVLPATKSIPKEMLPVFDRPAIQYVVDEAIAAGIEHFVFVTGRN
KAAIEDHFDTAYELEASLRMKGEEGLLAEITQSKPTPGSMSFVRQQAPLGLGHAIWCARD
IIGDDPFAILLPDVLVQAEPSCLAQMINVFDETGGNVIAVEQVPPAEVSKYGIIDPQSRD
GNRIRMRGMVEKPPVDAAPSNLSITGRYILQGSIFEYLADQAAGAGGEIQLTDAMARLME
TQDFHAVEYEGQSYDCGSKLGYLRATMAYARAHPSLGDGAQALIDEFSRT
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcgtccgcaaagctgtgctgccggttgccggctttggaacccgggttcttccc
gccaccaagtccatcccaaaggaaatgcttccagtcttcgaccgcccggcgatccagtat
gtcgtcgatgaagccattgctgccggcatcgagcacttcgtcttcgtgacgggtcgcaac
aaggctgcgatcgaggaccattttgacactgcctatgagctcgaggccagcttgagaatg
aaaggtgaggaaggcctccttgccgagataacccagtccaaacccactccaggctcgatg
agttttgtgcggcagcaggccccgctgggcctgggccatgcgatctggtgcgcccgcgac
atcatcggcgatgatccctttgccatcctgctgccggacgttctcgtccaggccgagccc
agctgcctcgcccagatgatcaatgtgttcgacgagaccggcggcaatgtgatcgcggtc
gaacaggtgccgcctgcggaagtcagcaaatacggaatcattgatccgcaatcgcgcgac
ggtaaccgcatccgaatgcgcggcatggtggaaaaaccgcccgttgatgctgccccgtcc
aatctctcgatcactggtcgctacatcctgcagggatcgattttcgaatacctggccgac
caggcagccggcgctggcggcgagatacaattgaccgacgccatggcgcgattgatggag
acccaggacttccatgccgtggagtatgaggggcagtcctatgactgcggcagcaaactc
ggctatctgcgcgcgaccatggcctacgcccgcgcccatcccagcctcggtgatggtgcc
caggccctgatcgatgaattcagccggacgtga

DBGET integrated database retrieval system