KEGG   Maricaulis maris: Mmar10_2493Help
Entry
Mmar10_2493       CDS       T00394                                 

Definition
serralysin (EC:3.4.24.40)
Orthology
K01406  
serralysin [EC:3.4.24.40]
Organism
mmr  Maricaulis maris
Brite
Enzymes [BR:mmr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.40  serralysin
     Mmar10_2493
Peptidases [BR:mmr01002]
 Metallo Peptidases
  Family M10
   Mmar10_2493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2709124..2714019)
Genome map
AA seq 1631 aa AA seqDB search
MPVVNKTEKASTVRNALLTTAMATGGALLLAGGAHAQGEAAGPPDGFTPLSDLSGVSRVD
VAADGSMQLVMSDGRTVLIAANDVAVVDGLYFISEAAIEANSLLGASAAAAGGGGGAAIL
GVLGGAGLLGAAAGGGGGGGSSPAPTPTPNTNPPVFSSATTASVDENTTGSVYTATATDA
DGNTISFSISGGADSGAFSINSSTGALTFTATPDFEAPADADGDNVYEVTIRASDGTNTT
DQTVTITVDDVDEAPSFTSGATASVDENTTGTVYTAAATDPEGAALTYTLSGADAALFAI
DPVTGAISFIAAPDFESPADADGDNVYEVTVTASDGTNSTDQAVSITVDPVDEGPATFSS
GTTASFDENATGTVYTAVAADPDNSTIIYSLGTAGDSALFAIDSATGALTFLAPPDFEAP
ADGDTDNVYDVTVSASDGTTVTTQIVQVTVNDVNEAPVVTSAATAGTSENNSGVVYTATA
TDPEGAALSYSLSGADAALFTINATSGEVSFLAPPDFEVPLDADGNNVYEITVTASDGSN
VDTQAVSITVTNQDEFAPVFTSATVDAVDEDSTGSFYTATATDGDGDTLTYSIVAGGDGA
LFTIDSATGELSFIASPDFENPTDADTDNVYDLALQVSDGTTNVTQALSVTVNNVNSAPV
ISSSGTATYTENDTSVAYTIAATDGDGDAITYSITGADAALFTVNAVTGAVSFVASPDFE
TPADANGDNVYEINVRASDGVLTTTQAVSITVENENDVAPVITSGATATIAENSAAVVYT
ATATDGDSASLSYSISGTDAALFQINSSTGAVSFITPADFENPGDAGADNVYDFTVTVSD
GDFTDSQAVAVTVTDVDESGGSAPVFSSGASQTVSENQTSAYVARAVDPDGDTVSYSISG
TDAALFAIDSSTGELRFLTTPDFESPTDSGSDNVYDVIVTASDGSNSNDQAVAITVGDVS
NEAADIPEGDTTQIQMVSGGDFTGTLEVAGDRDWVAVTLEAGQRYQFDAFGSGGAGVELD
DTYIRLYDASGTLIAENDDITLGVNTDSRLGFTATTSGTYYVSVGAWEPDSGATLSGQYT
LQVRHTDPLTAWNYQEIGDYLDSNGFGGLQWDRSAGDTITVNITALTVAGQTLARAALQL
WEDITGISFTEVATGGEITFDDDEEGAFAGPDATSGGFITAASVNVGTAWLDTYGTNIDG
YSFQTYIHEIGHALGLGHGGPYDGSADYAVDAIYLNDSWQASVMSYFSQNENTFIDADFG
YVIGPQVADIIAVLDMYGGSTSTRGGDTTYGYNSTAGNVIFDATAHSNPVSFTIFDTGGT
DTMDYSGSSANQTFDLREQAYSDLMGREGNVGIARGTVIENAIGGAGNDIFIGNDANNVL
TGGGGGDRFYASGGSDVFDGGSGSDTVVFSGASTDYSLTTNGSGNTVVTDNRTGAPDGVV
ELISVETIVYDGGTSNPEYFGDPDFAGREGLDPDDMPALAPFNPNEFDPDADRPVMDGLQ
DGEKGDRSEHVYPHLSDGDLALLLNLSDSIGDFRGEVGPNFWRNGEDARGDFRDAMLEWP
VELEGALQADKGHPVFETLTDPAAAGLPVSEAAEAGNYGLEFFQANAFTNVFDARDLQMM
TLSDDASDGWA
NT seq 4896 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttgtcaacaagaccgaaaaagcttcaaccgtgcgcaatgcgctcctgacgacc
gccatggcgaccggcggtgctcttttgctggccggcggtgcgcacgcccagggtgaggct
gcagggccgccggacgggtttaccccgctgtctgatctcagcggtgtctcgcgtgttgat
gtggccgctgatggttccatgcaattggtcatgtccgatggccggactgtgttgatcgca
gccaatgatgtcgcggtcgttgatggactttatttcatctctgaagccgcaatcgaagcg
aactctctgcttggcgcttcggcggctgctgccggtggcggcggaggcgcggccattctc
ggcgtactgggtggcgcaggcctgctcggcgcggcggcgggaggcggcggcggcggaggt
tccagccccgccccgacaccaacgcccaacaccaacccgccagtattcagctcggcgacg
actgcaagcgtggacgaaaacacgaccggaagcgtttatacggcgaccgccacggatgct
gacggcaataccatttctttctcgatcagcggtggcgcagactctggcgcattctcgatc
aacagttcgaccggcgctctgacattcaccgcgacgcccgatttcgaagcgccggccgat
gctgatggtgataatgtctatgaggtcaccatccgggcctccgacggcaccaacaccaca
gaccagaccgtcacgatcaccgttgacgacgtggatgaagctcccagcttcacgtcggga
gccacggcttcggtcgatgaaaacacgacgggtaccgtttacacggcggctgccaccgat
ccggaaggcgcggcgctaacctacacgttgtcaggcgctgatgcggccctttttgccatt
gatcccgtgaccggagccatcagcttcatcgctgcacctgactttgagagcccggctgat
gccgatggcgacaatgtctacgaagtcacggtgacggcgtccgatggaactaattcgacc
gaccaggcggtctccatcactgttgatcccgtggatgaaggccccgcgacgttctcttcc
ggtaccaccgcgagcttcgacgagaacgccaccggcaccgtctacacggccgttgcggcg
gatccggacaactcgaccatcatctattcgctggggacggccggagatagcgcgttgttc
gcgatcgacagcgcaaccggcgcactgaccttcctcgcgcctccggatttcgaggcaccg
gctgacggcgatacggacaatgtctacgacgtcaccgtgagtgccagtgacgggaccaca
gtcacgacccaaattgttcaggtcaccgtcaatgatgtgaacgaggcgccggtggtgacc
tcggcggcgaccgccggcacgtcagagaacaattcgggcgtggtctacaccgcgacggcg
accgatccggaaggcgcggccctgtcctattcgctgtccggcgccgatgctgcgctgttc
acgatcaacgctacctccggtgaggtcagtttcctcgcgccgcccgattttgaagtgccg
ctcgatgccgacggcaataatgtttacgagatcaccgtcaccgcgtctgatggcagcaat
gtcgatacgcaggcggtttcgatcacggtcaccaatcaggatgagttcgctccggtcttc
acgtcggcgacggtcgatgcggttgatgaagactcgaccggcagtttctatactgccacc
gcgaccgatggcgatggcgacacgctcacctattcgattgtggcgggcggcgacggcgcg
ctgttcacgattgacagcgcgaccggagaattgagcttcatcgcctcgccggacttcgag
aatccgaccgacgcggataccgacaatgtctatgatctcgctctgcaggtcagtgatgga
acgaccaatgtcacccaggcgctgagtgtcaccgtcaacaatgtgaactcagcaccggtg
atctcttcgtcgggcacggcaacatacaccgaaaacgacacgagcgtggcctataccatc
gcggcgaccgacggagacggcgacgcgatcacctattcgatcaccggcgcagatgcagcc
ttgttcacggtaaacgccgtaaccggcgcggtcagctttgtggcctcacctgacttcgag
acgcccgccgatgccaatggggacaatgtctatgagatcaatgtgcgtgcatccgacggt
gtcctgaccacgacgcaagccgtcagcatcacggtcgagaacgagaatgatgtggcacca
gtgattacctccggcgccaccgcgacaatcgccgagaacagtgctgcggtggtctacaca
gcgacggcaacggacggcgatagcgccagcctgagctattcaatctccggtaccgatgcg
gcgctgttccagatcaacagctcgactggcgcggtatcattcataaccccggcggacttt
gaaaatccgggcgatgccggtgctgacaacgtctatgatttcaccgtcaccgtgtctgat
ggcgactttacggacagccaggcggtcgcggttaccgtcaccgatgttgatgagtctggc
ggcagcgcgcccgtcttctcgtccggggcgagccaaaccgtttcggaaaatcagacatcg
gcttatgtcgcgcgggctgtcgaccccgacggcgacacggtcagctactcgatctccggg
accgatgcggcattgttcgccatcgattcatcaaccggtgaattgcgtttcctcacaacc
ccggacttcgagagcccgaccgacagcggcagtgacaatgtgtacgatgtcattgtcact
gcatccgatggcagcaattccaatgaccaggcggtcgcgatcacggtcggcgatgtaagc
aacgaggccgctgatattcccgaaggggacaccacccagatccagatggtctcgggcggc
gactttactggcaccctcgaagtggcaggtgatcgcgactgggtggccgtcacgctggaa
gcggggcagcgctaccaattcgacgcctttgggtccggtggagccggtgttgagctcgat
gacacctatatccgcctgtatgacgcatcgggaacactgatcgccgagaatgacgacatc
acccttggcgtgaatacggattcacgtctcggcttcaccgccacgacgtcgggtacctat
tacgtttcagtcggcgcctgggagccggacagcggggcaaccctgtccggccagtacacc
ctgcaggttcgccacacggacccgctgaccgcgtggaattaccaggaaatcggtgactat
ctcgattcaaacggcttcggtggcctgcagtgggaccgctccgccggcgacacgatcacg
gtcaacatcaccgctctgaccgtggccggccagaccctggcgcgtgcggccctgcaattg
tgggaagacattacggggatcagttttaccgaggtggcaacgggtggcgaaatcacgttt
gacgatgatgaggaaggtgcctttgcagggcccgacgcgacatctggcggcttcatcacc
gctgccagcgtcaatgttggtacagcttggctcgacacatatggaaccaatatcgacggc
tattccttccagacctacattcacgagatcggtcatgccctcggcctcggccacggtggc
ccctatgacggctccgccgattatgccgtggacgccatctatctgaacgattcctggcag
gcctcggtgatgtcgtacttctcgcagaacgagaacaccttcatcgatgccgattttggt
tatgtcatcgggccgcaggttgccgatatcattgcggttctggacatgtatggcggttcc
acgtcaacgcgcggcggtgacaccacctacggctataactctaccgccggaaatgtgatc
ttcgacgcaaccgcgcattcgaaccccgtcagtttcacaatctttgataccggcggcacc
gatacgatggactattccgggtcgtcggcgaaccagacatttgacctgcgcgagcaggct
tattcggacctgatgggtcgtgaaggcaatgtcggtatcgctcgcggtacggtcattgaa
aatgccattggcggcgccggcaatgacatctttatcggcaatgatgccaacaatgtcctg
accggcggcggcggcggggaccgtttctatgcctccggcggcagcgatgtttttgatggc
ggtagcggatcagacacggttgtcttctccggtgcgtccaccgattacagcctgacgaca
aacggctccggcaataccgttgtcaccgacaatcgcaccggcgcaccggacggtgtcgtc
gagctgatcagtgttgaaaccatcgtttatgacggcggcaccagcaatccggaatacttc
ggggatccggacttcgccggtcgagaaggtcttgatcctgacgacatgccggcgctggca
cccttcaatcccaacgagttcgaccctgacgccgatcgcccggtcatggatggtctgcaa
gatggtgagaagggggatcgttccgagcatgtctatccgcatctcagcgatggtgatctg
gccctgctgctgaacctgtcggactcaatcggcgatttccgtggcgaagtcggcccgaac
ttctggcgcaacggtgaagatgcccgcggtgatttccgtgacgccatgctcgaatggcct
gttgaattggagggggctctccaggcagacaaggggcatccggttttcgagacgctgact
gatccggctgccgcaggtctgccggtcagcgaggccgctgaagccggaaattatggtctc
gaattcttccaggccaacgcgttcaccaacgtgttcgacgcgcgtgatttgcagatgatg
accctgtcggatgatgcatccgacggctgggcctga

DBGET integrated database retrieval system